(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE100

ALDEN1_2.PE100       Location/Qualifiers
FT   CDS             109242..109511
FT                   /locus_tag="Alide_0101"
FT                   /gene_family="HOG000218362" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /codon_start="1"
FT                   /product="cell division topological specificity factor
FT                   mine"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0086 cell division topological
FT                   specificity factor MinE; TIGRFAM: cell division topological
FT                   specificity factor MinE; PFAM: Septum formation topological
FT                   specificity factor MinE"
FT                   /db_xref="GI:319760838"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="GeneID:10102124"
FT                   /translation="MSLLSFLLGEKKKTAAVAKERLQIILAHERSGRNAGKPDYLPALQ
FT                   RELVAVISKYVKINADDLKVHFERQDDLEVLEVKIELPEAAGGK"
FT                   /protein_id="YP_004124775.1"
     MSLLSFLLGE KKKTAAVAKE RLQIILAHER SGRNAGKPDY LPALQRELVA VISKYVKINA        60
     DDLKVHFERQ DDLEVLEVKI ELPEAAGGK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page