(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE102

ALDEN1_2.PE102       Location/Qualifiers
FT   CDS             110587..111564
FT                   /locus_tag="Alide_0103"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bpro_4513"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_4513 hypothetical protein"
FT                   /db_xref="GI:319760840"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102126"
FT                   /translation="MSHEILRLSRRSTILGLSLLPLAGYAQAYPAKPVSVVIPYSAGGT
FT                   TDIVARLIAQSLAASTGKTFVAENKGGGSTTIATGAVAKAAPDGYTLLANEMTQTIIPW
FT                   LFPKLSFDPIKDLLPVTVFAEAPYVLVVNSGVPAKSLRELVDLAKAQPGKLNFASGGAG
FT                   SGPHIAGELLKTVAGVDMTHVPYKGSGPAVADLLGGQVDVLITAAPTVTAQMGSGRMRP
FT                   LAVAHPRRLSSLPDVPTAAEAGFPDFRIANWFGLAAPKGTPAEVVAYLHAEVQKVLQRA
FT                   DVRDKLLAAGAEPVSMTPAEAARHVNAEARRWGELVRKAQIRLD"
FT                   /protein_id="YP_004124777.1"
     MSHEILRLSR RSTILGLSLL PLAGYAQAYP AKPVSVVIPY SAGGTTDIVA RLIAQSLAAS        60
     TGKTFVAENK GGGSTTIATG AVAKAAPDGY TLLANEMTQT IIPWLFPKLS FDPIKDLLPV       120
     TVFAEAPYVL VVNSGVPAKS LRELVDLAKA QPGKLNFASG GAGSGPHIAG ELLKTVAGVD       180
     MTHVPYKGSG PAVADLLGGQ VDVLITAAPT VTAQMGSGRM RPLAVAHPRR LSSLPDVPTA       240
     AEAGFPDFRI ANWFGLAAPK GTPAEVVAYL HAEVQKVLQR ADVRDKLLAA GAEPVSMTPA       300
     EAARHVNAEA RRWGELVRKA QIRLD                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page