(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE103

ALDEN1_2.PE103       Location/Qualifiers
FT   CDS             111592..112755
FT                   /locus_tag="Alide_0104"
FT                   /gene_family="HOG000113756" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /codon_start="1"
FT                   /product="mandelate racemase/muconate lactonizing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: mes:Meso_4537 galactonate dehydratase"
FT                   /db_xref="GI:319760841"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="GeneID:10102127"
FT                   /translation="MKIRKVEPLHVGQFMFVRITTDDGTVGYGEAGTWGHIEAAGVCIR
FT                   RFAEYLEGKDAFAIEHHWNVMHRFSYFTGLAENAAISAIDIALWDIKGKALNVPIYELL
FT                   GGAARTKARIYGHIYEHSIEKMLVECQAKMEAGFNAFGHLNPFLDEGNDQIYFKTHIKK
FT                   MRDAIDNTRRMREVVGDRVDLLIEIHRRLTPAEAIVFARGIEDTHPMFIEDPIRPEGPD
FT                   GMARVAEKIGIPIATGERFANLYEFQTLMARGGVEYARVDLCLCGGITGAKKVAAIAEA
FT                   HHVQVVPHNPLSPIGLAACLQLDAAIPNFAIQEYATGFEAGIFESRPEHLGSDIVDQVP
FT                   LPDAGFVDIPTGPGLGMNLLPDAQKIRPPLVKPISMRPHFDGFVVDQ"
FT                   /protein_id="YP_004124778.1"
     MKIRKVEPLH VGQFMFVRIT TDDGTVGYGE AGTWGHIEAA GVCIRRFAEY LEGKDAFAIE        60
     HHWNVMHRFS YFTGLAENAA ISAIDIALWD IKGKALNVPI YELLGGAART KARIYGHIYE       120
     HSIEKMLVEC QAKMEAGFNA FGHLNPFLDE GNDQIYFKTH IKKMRDAIDN TRRMREVVGD       180
     RVDLLIEIHR RLTPAEAIVF ARGIEDTHPM FIEDPIRPEG PDGMARVAEK IGIPIATGER       240
     FANLYEFQTL MARGGVEYAR VDLCLCGGIT GAKKVAAIAE AHHVQVVPHN PLSPIGLAAC       300
     LQLDAAIPNF AIQEYATGFE AGIFESRPEH LGSDIVDQVP LPDAGFVDIP TGPGLGMNLL       360
     PDAQKIRPPL VKPISMRPHF DGFVVDQ                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page