(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE104

ALDEN1_2.PE104       Location/Qualifiers
FT   CDS             complement(112786..113325)
FT                   /locus_tag="Alide_0105"
FT                   /gene_family="HOG000115783" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /codon_start="1"
FT                   /product="flavin reductase domain protein fmn-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0068 flavin reductase
FT                   domain-containing protein; manually curated; PFAM: flavin
FT                   reductase domain protein FMN-binding"
FT                   /db_xref="GI:319760842"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="GeneID:10102128"
FT                   /translation="MNSTHHPSPPAFSPREFRDALGMFATGVTIVTTRGAGGELVGMTV
FT                   NSFNSVSLDPPLVLWSLAHKASSLQAFASATHYAINVLTVEQRALAERFATRGIDRWAG
FT                   VAHRPGLHDMPVIEGVAAVFECTNRSQYAEGDHTIFVGRVERCTHLRGASPLLYHGGMF
FT                   YTEHALGQLADTVIGP"
FT                   /protein_id="YP_004124779.1"
     MNSTHHPSPP AFSPREFRDA LGMFATGVTI VTTRGAGGEL VGMTVNSFNS VSLDPPLVLW        60
     SLAHKASSLQ AFASATHYAI NVLTVEQRAL AERFATRGID RWAGVAHRPG LHDMPVIEGV       120
     AAVFECTNRS QYAEGDHTIF VGRVERCTHL RGASPLLYHG GMFYTEHALG QLADTVIGP        179
//

If you have problems or comments...

PBIL Back to PBIL home page