(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE106

ALDEN1_2.PE106       Location/Qualifiers
FT   CDS             114282..114947
FT                   /locus_tag="Alide_0107"
FT                   /gene_family="HOG000224898" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="regulatory protein tetr"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ajs:Ajs_0073
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:319760844"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:10102130"
FT                   /translation="MAFMNTLSQPRPSFKEQMHRAREDAIVEAACRLLGEKGFETMTVD
FT                   EVACAVGIAKASLYKHFAGKDDLCAAAMVHVVGRLQRFLDELPEGLQALQRLQALLRWL
FT                   LELQLGDETPLLPSRNSALAQALRTCDAYRASMEEVHARILGWIAEAQAAAQLRRELPP
FT                   EVILCALLARSTDPMLAMLRERGHGDAQILDWAVATCLGGLVSAPAAPERCSWPAPGC"
FT                   /protein_id="YP_004124781.1"
     MAFMNTLSQP RPSFKEQMHR AREDAIVEAA CRLLGEKGFE TMTVDEVACA VGIAKASLYK        60
     HFAGKDDLCA AAMVHVVGRL QRFLDELPEG LQALQRLQAL LRWLLELQLG DETPLLPSRN       120
     SALAQALRTC DAYRASMEEV HARILGWIAE AQAAAQLRRE LPPEVILCAL LARSTDPMLA       180
     MLRERGHGDA QILDWAVATC LGGLVSAPAA PERCSWPAPG C                           221
//

If you have problems or comments...

PBIL Back to PBIL home page