(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE107

ALDEN1_2.PE107       Location/Qualifiers
FT   CDS             complement(114895..115317)
FT                   /locus_tag="Alide_0108"
FT                   /gene_family="HOG000238897" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /codon_start="1"
FT                   /product="uspa domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UspA domain-containing protein; KEGG:
FT                   ajs:Ajs_0074 UspA domain-containing protein"
FT                   /db_xref="GI:319760845"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="GeneID:10102131"
FT                   /translation="MNILLAVDGSTYTKKMLAYLAAHDEMLGSSHTYTAITVQPPLPPR
FT                   ARAALGKETVDSYYADEGEKVLSPVVKFMGRHGVQPKTMIKVGPAGETIAKVAESGKYD
FT                   LVVMGTHGHGSLGKLVMGSVSTQVLANCTVPVLLVR"
FT                   /protein_id="YP_004124782.1"
     MNILLAVDGS TYTKKMLAYL AAHDEMLGSS HTYTAITVQP PLPPRARAAL GKETVDSYYA        60
     DEGEKVLSPV VKFMGRHGVQ PKTMIKVGPA GETIAKVAES GKYDLVVMGT HGHGSLGKLV       120
     MGSVSTQVLA NCTVPVLLVR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page