(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE109

ALDEN1_2.PE109       Location/Qualifiers
FT   CDS             complement(116291..117262)
FT                   /locus_tag="Alide_0110"
FT                   /gene_family="HOG000103695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0076 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760847"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102133"
FT                   /translation="MPSLNFRTLDLNLLRVFDEVMAERNLTRAAEKLAITQPAVSNALR
FT                   RLREAVGDELLVRSGHGVEPTPRALALWPAVRQALGQLQESLAPGGFEPASAQATFVLA
FT                   MADATGATLIPPLIEITEREAPGISLRVIPLTTRDPRRLLDDGTIDMAVGYFPAVLADL
FT                   TARAQADNVVAHESVRLYASQYVCVMRAGHPLADAPLSLDQYCAAHHLLVSFSGKPYGF
FT                   IDEALAALGRERRIVLTVNQFFTAGRVVATTDLLTVLPLHFVGLADVGGDLVWRPLPMP
FT                   LPTVHVDALWHRRRLYDPAHRWLRETIARAARNTPTPITLRD"
FT                   /protein_id="YP_004124784.1"
     MPSLNFRTLD LNLLRVFDEV MAERNLTRAA EKLAITQPAV SNALRRLREA VGDELLVRSG        60
     HGVEPTPRAL ALWPAVRQAL GQLQESLAPG GFEPASAQAT FVLAMADATG ATLIPPLIEI       120
     TEREAPGISL RVIPLTTRDP RRLLDDGTID MAVGYFPAVL ADLTARAQAD NVVAHESVRL       180
     YASQYVCVMR AGHPLADAPL SLDQYCAAHH LLVSFSGKPY GFIDEALAAL GRERRIVLTV       240
     NQFFTAGRVV ATTDLLTVLP LHFVGLADVG GDLVWRPLPM PLPTVHVDAL WHRRRLYDPA       300
     HRWLRETIAR AARNTPTPIT LRD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page