(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE11

ALDEN1_2.PE11        Location/Qualifiers
FT   CDS             complement(13882..15045)
FT                   /locus_tag="Alide_0011"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reh:H16_A2143 acyl-CoA dehydrogenase,
FT                   long-chain specific"
FT                   /db_xref="GI:319760749"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102034"
FT                   /translation="MMTSDHIALQDSVRKLIEREIEPHVDEWEAAEIFPAHEVFKKLGS
FT                   AGFLGVNKPVEFGGMGLDYSYEIAFCEAIGGISSGGVGMAIAVQTDMATPALTHFGSDE
FT                   LRELFLKPTVAGDMVVCLGVSESGAGSDVASLKTTARKDGDDYVINGSKMWITNGTQAD
FT                   WMCLLANTSEGDVHRNKSLICLPLRENGKLRPGISMQKIKKVGMWASDTAQVFFDEVRV
FT                   PQRYRIGEEGKGFTYQMRQFQEERLSGATRRVTALSNVIDETIAYTRQRKAFGRSILDN
FT                   QAVHFRLAELKTEVEMLRSLIYRAAQVHMGGGDMTELASMAKLKAGRLCREVTDSCLQY
FT                   WGGMGFTWENKVSRAWRDLRLISIGGGADEIMLTIICKHMGILPKRA"
FT                   /protein_id="YP_004124686.1"
     MMTSDHIALQ DSVRKLIERE IEPHVDEWEA AEIFPAHEVF KKLGSAGFLG VNKPVEFGGM        60
     GLDYSYEIAF CEAIGGISSG GVGMAIAVQT DMATPALTHF GSDELRELFL KPTVAGDMVV       120
     CLGVSESGAG SDVASLKTTA RKDGDDYVIN GSKMWITNGT QADWMCLLAN TSEGDVHRNK       180
     SLICLPLREN GKLRPGISMQ KIKKVGMWAS DTAQVFFDEV RVPQRYRIGE EGKGFTYQMR       240
     QFQEERLSGA TRRVTALSNV IDETIAYTRQ RKAFGRSILD NQAVHFRLAE LKTEVEMLRS       300
     LIYRAAQVHM GGGDMTELAS MAKLKAGRLC REVTDSCLQY WGGMGFTWEN KVSRAWRDLR       360
     LISIGGGADE IMLTIICKHM GILPKRA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page