(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE110

ALDEN1_2.PE110       Location/Qualifiers
FT   CDS             117388..117828
FT                   /locus_tag="Alide_0111"
FT                   /gene_family="HOG000224899" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0077"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0077 hypothetical protein"
FT                   /db_xref="GI:319760848"
FT                   /db_xref="GeneID:10102134"
FT                   /translation="MTKFAVIEFPSQHQGVARIEGAVSHLRRSATRFDPTRNGASLLLA
FT                   ALVAALLVVANEMVDTWGDGHLLAGWMLMWLIAFVGMALLAAPARRAVALLRGAAKSWS
FT                   DARRRAAEDERTWNAALHDARIMADLSRAMNGIAVEDMRRYR"
FT                   /protein_id="YP_004124785.1"
     MTKFAVIEFP SQHQGVARIE GAVSHLRRSA TRFDPTRNGA SLLLAALVAA LLVVANEMVD        60
     TWGDGHLLAG WMLMWLIAFV GMALLAAPAR RAVALLRGAA KSWSDARRRA AEDERTWNAA       120
     LHDARIMADL SRAMNGIAVE DMRRYR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page