(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE111

ALDEN1_2.PE111       Location/Qualifiers
FT   CDS             complement(117968..119836)
FT                   /locus_tag="Alide_0112"
FT                   /gene_family="HOG000191700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.32"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0114 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="GI:319760849"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="GeneID:10102135"
FT                   /translation="MNAPSMQGLSLQAPAYVKNARLIAWVAEMAALCKPAAIHWCDGSQ
FT                   EEYDQLCQQLVNAGTFKKLNPAKRPGSYLACSDPSDVARVEDRTFICSEKKEDAGPTNN
FT                   WMAPNEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSPIAHVGVELSDSAYVAVNMKIMT
FT                   RMGKAVYDVIGTDGEFVPCMHTVGAPLKAGEKDQTSWPCNPQVKYIVHYPETREIWSYG
FT                   SGYGGNALLGKKCLALRIASTMGRDQGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKT
FT                   NFSMLVPPKAFEGWKVTTIGDDIAWIKPQPDGSLRAINPEAGYFGVAPGTNYHTNPNCM
FT                   ASLNKDVIFTNVALTDDGDVWWEGMEKDTGVVPGHLIDWQGRDWTPQIAKETGAKAAHP
FT                   NARFTVAATNNPALDEAWDDPKGVKIDAFIFGGRRSTTVPLVTEARTWTEGVYMAATMG
FT                   SETTAAAFGAQGVVRRDPFAMLPFMGYNMSDYFQHWLDLGAKIAGQGAALPRIFTTNWF
FT                   RKNAEGKFVWPGYGENMRVLKWMIDRIESRAQGLETAFGIAPAFAEINWNGLEFSAEQF
FT                   ESVTSIDKSVWAEELKLHTEHFDKLAHHLPQELLATKAALEKRLAA"
FT                   /product="phosphoenolpyruvate carboxykinase (gtp)"
FT                   /protein_id="YP_004124786.1"
     MNAPSMQGLS LQAPAYVKNA RLIAWVAEMA ALCKPAAIHW CDGSQEEYDQ LCQQLVNAGT        60
     FKKLNPAKRP GSYLACSDPS DVARVEDRTF ICSEKKEDAG PTNNWMAPNE MRATLQPLFD       120
     GCMAGRTMYV VPFSMGPLGS PIAHVGVELS DSAYVAVNMK IMTRMGKAVY DVIGTDGEFV       180
     PCMHTVGAPL KAGEKDQTSW PCNPQVKYIV HYPETREIWS YGSGYGGNAL LGKKCLALRI       240
     ASTMGRDQGW LAEHMLILGV TNPEGKKYHV AAAFPSACGK TNFSMLVPPK AFEGWKVTTI       300
     GDDIAWIKPQ PDGSLRAINP EAGYFGVAPG TNYHTNPNCM ASLNKDVIFT NVALTDDGDV       360
     WWEGMEKDTG VVPGHLIDWQ GRDWTPQIAK ETGAKAAHPN ARFTVAATNN PALDEAWDDP       420
     KGVKIDAFIF GGRRSTTVPL VTEARTWTEG VYMAATMGSE TTAAAFGAQG VVRRDPFAML       480
     PFMGYNMSDY FQHWLDLGAK IAGQGAALPR IFTTNWFRKN AEGKFVWPGY GENMRVLKWM       540
     IDRIESRAQG LETAFGIAPA FAEINWNGLE FSAEQFESVT SIDKSVWAEE LKLHTEHFDK       600
     LAHHLPQELL ATKAALEKRL AA                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page