(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE114

ALDEN1_2.PE114       Location/Qualifiers
FT   CDS             complement(121729..123390)
FT                   /locus_tag="Alide_0115"
FT                   /gene_family="HOG000253935" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0081 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319760852"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="GeneID:10102138"
FT                   /translation="MDWTTHHVFNQFPELYDYDPLATDPALCEALARTGAGWARPALNG
FT                   YAARLGRTETYMLAEQANRHLPELRRFDSRGRRIDALEFHPGWHALMALYRGQGLVSQP
FT                   FREARAGRWAAWAAGFYLHGQVEQGTLCPATMTQAAIPLLQKEPALWAQLQERLYSDAY
FT                   DARDLPVQDKASIWLGMGMTEKQGGSDVRANTTVATAVGAGGRGGEYLLRGHKWFFSAP
FT                   QCDAHLVTARVQEGGPFACFYVPRWRPDGSRNAVRVQRLKDKLGNRSNASGEVEFEDAW
FT                   GVLMGEEGRGIPTIIEMAGYTRLNCVAGSAAILRQATVQAIAYARQRHAFGKALAEQPL
FT                   MRAVLADLALESEASLVLLMRLAEAFEREGDGDPAQRAWKRAMTPAAKFWVCKRAVELT
FT                   GEAMEVFGGNGYVEDGVMARLFREAPVNSIWEGSGNVMCLDVLRALAREPGAARALLAE
FT                   LQPAAQGEPRIAAALQGLQALLAASADELEALGRVLAQRLVLVAQACLLRAHAPACVAD
FT                   AFIATRLGDGGAGRVAGAIDTRGMDVDAILARAFPA"
FT                   /protein_id="YP_004124789.1"
     MDWTTHHVFN QFPELYDYDP LATDPALCEA LARTGAGWAR PALNGYAARL GRTETYMLAE        60
     QANRHLPELR RFDSRGRRID ALEFHPGWHA LMALYRGQGL VSQPFREARA GRWAAWAAGF       120
     YLHGQVEQGT LCPATMTQAA IPLLQKEPAL WAQLQERLYS DAYDARDLPV QDKASIWLGM       180
     GMTEKQGGSD VRANTTVATA VGAGGRGGEY LLRGHKWFFS APQCDAHLVT ARVQEGGPFA       240
     CFYVPRWRPD GSRNAVRVQR LKDKLGNRSN ASGEVEFEDA WGVLMGEEGR GIPTIIEMAG       300
     YTRLNCVAGS AAILRQATVQ AIAYARQRHA FGKALAEQPL MRAVLADLAL ESEASLVLLM       360
     RLAEAFEREG DGDPAQRAWK RAMTPAAKFW VCKRAVELTG EAMEVFGGNG YVEDGVMARL       420
     FREAPVNSIW EGSGNVMCLD VLRALAREPG AARALLAELQ PAAQGEPRIA AALQGLQALL       480
     AASADELEAL GRVLAQRLVL VAQACLLRAH APACVADAFI ATRLGDGGAG RVAGAIDTRG       540
     MDVDAILARA FPA                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page