(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE115

ALDEN1_2.PE115       Location/Qualifiers
FT   CDS             complement(123446..126166)
FT                   /locus_tag="Alide_0116"
FT                   /gene_family="HOG000265624" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /codon_start="1"
FT                   /product="magnesium-translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_4078 magnesium-transporting ATPase
FT                   MgtA; TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760853"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015444"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102139"
FT                   /translation="MHPHIPREVFAGFLRTRRMVRHFRRRALLETLGRTGVSRELPAAQ
FT                   SRALAAAADADAGALLRQLGSAETGLTEAQADAMRERAGPNEVEHEKPLPWWVHLWHCF
FT                   RTPFSLLLTLLAAISLFTRDMKGALVIGTMVVLATLLRFWQEGRSSKAADALKAMVGNT
FT                   ATVLRGSLPEDAGVRRVELPIRLLVPGDLVVLSAGDMIPADCRVLAAKDLFVAQAAMTG
FT                   ESMPVEKSAARCGAGAGNPLELDNIVFMGTNVVSGSATAVVLATGGGTYFGALAGRVIA
FT                   TDRAPTSFQSGVNKVSWLLIRFMSAMAPLVFFINGFSKGDWLEALLFALAIAVGLTPEM
FT                   LPMIVTSTLAKGAVFLSRKKVIVKRLDAIQNFGAMDVLCTDKTGTLTQDRIFLARHVDA
FT                   WGEESGDVLELAYLNSYYQTGLKNLLDVAVLEHAEVHRELEPARNFRKVDEIPFDFDRR
FT                   RMSVVVAEHGAHHLLITKGAVEEVLAVCTQVRHGAATEPLTPALLERIRAVTAGLNEEG
FT                   LRVVAVAARQGPPTQDVYGLADESALTLVGYVAFLDPPKDSTAAALKALAGRSVAVKVL
FT                   TGDNELVAAKICREVGLAQQGVLRGGDVERMGDEELGHAVERHNLFARLTPMHKERIVR
FT                   RLKANGHVVGFMGDGINDAPALRAADIGISVDSAVDIAKEAADIILLEKSLMVLEQGVQ
FT                   EGRRTFANMLKYIRMTASSNFGNVLSVLTASAFIPFLPMLPIHLLVQNLLYDISQIAIP
FT                   FDNVDEELLRRPLRWQPGDIGRFMVFFGPVSSVFDITTFAMMWFVFGAQTPAQQTLFQS
FT                   GWFVVGLLTQTLIVHMIRSPGLPFVQSRAATPLLVMTGAIMAVGIFLPMGPLAHYFRLQ
FT                   ALPPLYFALLPAIVLGYMAATQAMKGIYRRRWGWQ"
FT                   /protein_id="YP_004124790.1"
     MHPHIPREVF AGFLRTRRMV RHFRRRALLE TLGRTGVSRE LPAAQSRALA AAADADAGAL        60
     LRQLGSAETG LTEAQADAMR ERAGPNEVEH EKPLPWWVHL WHCFRTPFSL LLTLLAAISL       120
     FTRDMKGALV IGTMVVLATL LRFWQEGRSS KAADALKAMV GNTATVLRGS LPEDAGVRRV       180
     ELPIRLLVPG DLVVLSAGDM IPADCRVLAA KDLFVAQAAM TGESMPVEKS AARCGAGAGN       240
     PLELDNIVFM GTNVVSGSAT AVVLATGGGT YFGALAGRVI ATDRAPTSFQ SGVNKVSWLL       300
     IRFMSAMAPL VFFINGFSKG DWLEALLFAL AIAVGLTPEM LPMIVTSTLA KGAVFLSRKK       360
     VIVKRLDAIQ NFGAMDVLCT DKTGTLTQDR IFLARHVDAW GEESGDVLEL AYLNSYYQTG       420
     LKNLLDVAVL EHAEVHRELE PARNFRKVDE IPFDFDRRRM SVVVAEHGAH HLLITKGAVE       480
     EVLAVCTQVR HGAATEPLTP ALLERIRAVT AGLNEEGLRV VAVAARQGPP TQDVYGLADE       540
     SALTLVGYVA FLDPPKDSTA AALKALAGRS VAVKVLTGDN ELVAAKICRE VGLAQQGVLR       600
     GGDVERMGDE ELGHAVERHN LFARLTPMHK ERIVRRLKAN GHVVGFMGDG INDAPALRAA       660
     DIGISVDSAV DIAKEAADII LLEKSLMVLE QGVQEGRRTF ANMLKYIRMT ASSNFGNVLS       720
     VLTASAFIPF LPMLPIHLLV QNLLYDISQI AIPFDNVDEE LLRRPLRWQP GDIGRFMVFF       780
     GPVSSVFDIT TFAMMWFVFG AQTPAQQTLF QSGWFVVGLL TQTLIVHMIR SPGLPFVQSR       840
     AATPLLVMTG AIMAVGIFLP MGPLAHYFRL QALPPLYFAL LPAIVLGYMA ATQAMKGIYR       900
     RRWGWQ                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page