(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE116

ALDEN1_2.PE116       Location/Qualifiers
FT   CDS             complement(126301..127332)
FT                   /locus_tag="Alide_0117"
FT                   /gene_family="HOG000265279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /codon_start="1"
FT                   /product="homocysteine s-methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ajs:Ajs_0083 methionine synthase (B12-dependent)"
FT                   /db_xref="GI:319760854"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:10102140"
FT                   /translation="MTLPHYTRAQQLPAILEQRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFARDVKGNNELLSLTRPNVIRDIHEGYLAAGADLIETNTFGATSIAQEDYGMADLA
FT                   YEMNLESARLARAACGKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVTFEQLRA
FT                   AYLEQTLALIAGGADVLLVETIFDTLNAKAALFAIDEAFEQTGECLPIMISGTVTDASG
FT                   RILSGQTVTAFWHSVRHANPLSIGLNCALGAALMRPYIQELAKAAPDTFISCYPNAGLP
FT                   NPMSDTGFDETPEVTSRLVHEFATERLVNIVGGCCGTTPDHIGAIARAVAPVGARRLFS
FT                   AVS"
FT                   /protein_id="YP_004124791.1"
     MTLPHYTRAQ QLPAILEQRI AILDGAMGTM IQRFKLTEEQ YRGERFKDFA RDVKGNNELL        60
     SLTRPNVIRD IHEGYLAAGA DLIETNTFGA TSIAQEDYGM ADLAYEMNLE SARLARAACG       120
     KFSTPDKPRF VAGALGPTPK TASISPDVND PGARNVTFEQ LRAAYLEQTL ALIAGGADVL       180
     LVETIFDTLN AKAALFAIDE AFEQTGECLP IMISGTVTDA SGRILSGQTV TAFWHSVRHA       240
     NPLSIGLNCA LGAALMRPYI QELAKAAPDT FISCYPNAGL PNPMSDTGFD ETPEVTSRLV       300
     HEFATERLVN IVGGCCGTTP DHIGAIARAV APVGARRLFS AVS                         343
//

If you have problems or comments...

PBIL Back to PBIL home page