(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE119

ALDEN1_2.PE119       Location/Qualifiers
FT   CDS             complement(129515..129898)
FT                   /locus_tag="Alide_0120"
FT                   /gene_family="HOG000224904" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aav:Aave_0177 cupin 2 domain-containing protein"
FT                   /db_xref="GI:319760857"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10102143"
FT                   /translation="MTTSRYLVRAADVPSYQPANHHHTHNQRLIGPETVGAKQMEVLLG
FT                   TLHKGGGALPHAHPGIEQACYLLEGTARAQVEDEAFDMVPGDMCFFPADKMHVFTVTSD
FT                   QPVKLLVIYSPPYGESPDKVIRP"
FT                   /protein_id="YP_004124794.1"
     MTTSRYLVRA ADVPSYQPAN HHHTHNQRLI GPETVGAKQM EVLLGTLHKG GGALPHAHPG        60
     IEQACYLLEG TARAQVEDEA FDMVPGDMCF FPADKMHVFT VTSDQPVKLL VIYSPPYGES       120
     PDKVIRP                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page