(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE12

ALDEN1_2.PE12        Location/Qualifiers
FT   CDS             complement(15177..16787)
FT                   /locus_tag="Alide_0012"
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /codon_start="1"
FT                   /EC_number="6.4.1.4"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2144 propionyl-CoA carboxylase beta
FT                   chain; PFAM: carboxyl transferase"
FT                   /db_xref="GI:319760750"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="GeneID:10102035"
FT                   /translation="MAEKTGTGQAPGGAQRNRAHMLERIDEVRRLEQRAVERSARSARH
FT                   FHAQGKLLPRERLAHLLDADRPFYELMTLSGYCGLEDPNPATSVPGSALIVGIGHISGV
FT                   RCMVAVNDSGISAGAMQALTGQKLIRAQEIALAQKLPFVQLVESAGGNLRKYRVERFVV
FT                   GGGMFYSLARLSAAGLPVVALIHGSSAAGGAYLPGLSDYVVMVRGQAHAYLAGPSLLKA
FT                   ATGEEASDEELGGADMHAAVSGLADYVADNDLDGIMRVREIMQRIGWHGAPAPQAAPPL
FT                   HDADELLAIMPADMRTPVDMREVIARLVDGSEFHAFKERFGPATVCGYAAIEGHAVGIL
FT                   TNNGPLDSDGSNKAAQFIQLCVQLGRPLVFLQNITGFMVGRRHEEAGMIKHGAKLIQAL
FT                   SNAPVPRFTVLCGASYGAGNYGMCGRAFKPDLLFSWPNARTAVMGGEQAAMTMRTVAEN
FT                   AARRGGKDVDEQALAAESRAIVHTFESQSSAIHTSSLLLDDGVIDPRETRAWLGMALAT
FT                   AFDARERAVQPMQFGVARL"
FT                   /product="methylcrotonoyl-CoA carboxylase"
FT                   /protein_id="YP_004124687.1"
     MAEKTGTGQA PGGAQRNRAH MLERIDEVRR LEQRAVERSA RSARHFHAQG KLLPRERLAH        60
     LLDADRPFYE LMTLSGYCGL EDPNPATSVP GSALIVGIGH ISGVRCMVAV NDSGISAGAM       120
     QALTGQKLIR AQEIALAQKL PFVQLVESAG GNLRKYRVER FVVGGGMFYS LARLSAAGLP       180
     VVALIHGSSA AGGAYLPGLS DYVVMVRGQA HAYLAGPSLL KAATGEEASD EELGGADMHA       240
     AVSGLADYVA DNDLDGIMRV REIMQRIGWH GAPAPQAAPP LHDADELLAI MPADMRTPVD       300
     MREVIARLVD GSEFHAFKER FGPATVCGYA AIEGHAVGIL TNNGPLDSDG SNKAAQFIQL       360
     CVQLGRPLVF LQNITGFMVG RRHEEAGMIK HGAKLIQALS NAPVPRFTVL CGASYGAGNY       420
     GMCGRAFKPD LLFSWPNART AVMGGEQAAM TMRTVAENAA RRGGKDVDEQ ALAAESRAIV       480
     HTFESQSSAI HTSSLLLDDG VIDPRETRAW LGMALATAFD ARERAVQPMQ FGVARL           536
//

If you have problems or comments...

PBIL Back to PBIL home page