(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE121

ALDEN1_2.PE121       Location/Qualifiers
FT   CDS             131138..133006
FT                   /locus_tag="Alide_0122"
FT                   /gene_family="HOG000044388" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /codon_start="1"
FT                   /product="ATP-dependent DNA helicase recq"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecQ;
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: RQC domain;
FT                   helicase domain protein; DEAD/DEAH box helicase domain
FT                   protein; HRDC domain protein; KEGG: dia:Dtpsy_0103
FT                   ATP-dependent DNA helicase RecQ; SMART: helicase domain
FT                   protein; DEAD-like helicase ; HRDC domain protein"
FT                   /db_xref="GI:319760859"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018329"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="GeneID:10102145"
FT                   /translation="MSPAHFVLHDVFGYDQFRGPQQAIIDHVIAGGDALVLMPTGGGKS
FT                   LCYQVPAIVRRDAGRGVTVVVSPLIALMHDQVGALHEAGVEAAFLNSTLDWQQTLDVER
FT                   RLSRGEITLLYAAPERVTTDRFLGLLDGLHERGLLSLFAIDEAHCVSQWGHDFRPEYRQ
FT                   LSILHERYPRVPRIALTATADALTRADIVEGLRLQEARQFVSSFDRPNIRYRLEEKKEP
FT                   LTQLMRFIDREHLGDAGVVYCQSRKRVEELAQALCDAGLTALPYHAGLPAEVRQQNQDR
FT                   FLREDGIVMVATIAFGMGIDKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLPADAWMAY
FT                   GLQDVVNQRRMIDESPAGEEFKAVMRGKLDALLALAEATDCRRVRLLGYFGEQSEPCGN
FT                   CDNCLNPPAVWDGTDAARKLLSTIYRVHQASGISFGTGHIMDIVRGKDTDKVRQFGHEK
FT                   LSTFGVGKEYTEAQLRGVLRQLLATGAVGLHKVMLESGHSFDTLVLTDGSRPVLRGEQH
FT                   VQLREATAQAQAAAKPKRARRAATPPVAAANLGQDAQVRFINLKAWRAEVAREHNLPAY
FT                   VIFHDATLAAIAERNPATLDELQGISGMGVKKLEAYGEDVVRVCRQ"
FT                   /protein_id="YP_004124796.1"
     MSPAHFVLHD VFGYDQFRGP QQAIIDHVIA GGDALVLMPT GGGKSLCYQV PAIVRRDAGR        60
     GVTVVVSPLI ALMHDQVGAL HEAGVEAAFL NSTLDWQQTL DVERRLSRGE ITLLYAAPER       120
     VTTDRFLGLL DGLHERGLLS LFAIDEAHCV SQWGHDFRPE YRQLSILHER YPRVPRIALT       180
     ATADALTRAD IVEGLRLQEA RQFVSSFDRP NIRYRLEEKK EPLTQLMRFI DREHLGDAGV       240
     VYCQSRKRVE ELAQALCDAG LTALPYHAGL PAEVRQQNQD RFLREDGIVM VATIAFGMGI       300
     DKPDVRFVAH VDMPKNIEGY YQETGRAGRD GLPADAWMAY GLQDVVNQRR MIDESPAGEE       360
     FKAVMRGKLD ALLALAEATD CRRVRLLGYF GEQSEPCGNC DNCLNPPAVW DGTDAARKLL       420
     STIYRVHQAS GISFGTGHIM DIVRGKDTDK VRQFGHEKLS TFGVGKEYTE AQLRGVLRQL       480
     LATGAVGLHK VMLESGHSFD TLVLTDGSRP VLRGEQHVQL REATAQAQAA AKPKRARRAA       540
     TPPVAAANLG QDAQVRFINL KAWRAEVARE HNLPAYVIFH DATLAAIAER NPATLDELQG       600
     ISGMGVKKLE AYGEDVVRVC RQ                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page