(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE122

ALDEN1_2.PE122       Location/Qualifiers
FT   CDS             complement(133010..133690)
FT                   /locus_tag="Alide_0123"
FT                   /gene_family="HOG000228031" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0085 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="GI:319760860"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="GeneID:10102146"
FT                   /translation="MAAATPAEALRIGGLTPLTTIDFPGRLAAVVFCQGCPWRCGYCHN
FT                   TGLLDAATPTAHAWADVQQLLHARRGLLDGVVFSGGEPTLQAGLPDALARVRAMGFATG
FT                   LHTAGMYPERLATLLPLLDWVGLDIKAPLHRYDAITRTPGSGAKAWESLRLVLASGVAH
FT                   ECRTTWNAGLYGDDDLQALADALAAEGVQHWALQECRTDGAPAWAPPQAVAQRWPGTFT
FT                   LRRA"
FT                   /protein_id="YP_004124797.1"
     MAAATPAEAL RIGGLTPLTT IDFPGRLAAV VFCQGCPWRC GYCHNTGLLD AATPTAHAWA        60
     DVQQLLHARR GLLDGVVFSG GEPTLQAGLP DALARVRAMG FATGLHTAGM YPERLATLLP       120
     LLDWVGLDIK APLHRYDAIT RTPGSGAKAW ESLRLVLASG VAHECRTTWN AGLYGDDDLQ       180
     ALADALAAEG VQHWALQECR TDGAPAWAPP QAVAQRWPGT FTLRRA                      226
//

If you have problems or comments...

PBIL Back to PBIL home page