(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE124

ALDEN1_2.PE124       Location/Qualifiers
FT   CDS             complement(133951..135981)
FT                   /locus_tag="Alide_0125"
FT                   /gene_family="HOG000100301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0106 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP-cone
FT                   domain protein"
FT                   /db_xref="GI:319760862"
FT                   /db_xref="GO:0008998"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="GeneID:10102148"
FT                   /translation="MTPPPAPVATLPRDVIQRNGERAAFDAERIRSAIARAGSATGDFG
FT                   ADEAQLLTAQATKVLIHRFRGEAPAIEQIQDVVEQTLIAANHLQTARAYMAHRQRHALL
FT                   RADRQTLVHVESSINEYLTRADWRVNANANQGYSLGGLILNVAGKVTANYWLSHVYAPE
FT                   IGEAHRSGDIHIHDLDMLSGYCAGWSLRTLLHEGLNGVPGKVEAGPPKHMSSAVGQIVN
FT                   FLGTLQNEWAGAQAFSSFDTYMAPFVRKDAMDYAAVRQCIQELVYNLNVPSRWGTQTPF
FT                   TNLTFDWTCPEDLREQVPVIGGEEMPSSYGELQAEMDLINRAYIDVMTTGDAKGRVFTF
FT                   PIPTYNITPDFPWESENAAALFDMTAKYGLPYFQNFINSELSPNMVRSMCCRLQLDLRE
FT                   LLKRGNGLFGSAEQTGSLGVVTVNCARLGYLHAGDEASLFAALDRLLELGKQSLEVKRK
FT                   LIQRLMDQGLFPYTKRYLGTLRNHFSTLGVNGINEMIRNFTADAHDITSEWGHAFAVRL
FT                   LDHVRARMTAFQEETGHLYNLEATPAEGTTYRFAKEDKKRWPAILQAGTAEQPYYTNSS
FT                   QLPVGFTDDPFEALQRQEALQGKYTGGTVLHLYMGERISSGAACRELVKRALTNFRLPY
FT                   ITVTPTFSICPTHGYLAGEHPFCPTCDEERLEAKRRRLLAA"
FT                   /protein_id="YP_004124799.1"
     MTPPPAPVAT LPRDVIQRNG ERAAFDAERI RSAIARAGSA TGDFGADEAQ LLTAQATKVL        60
     IHRFRGEAPA IEQIQDVVEQ TLIAANHLQT ARAYMAHRQR HALLRADRQT LVHVESSINE       120
     YLTRADWRVN ANANQGYSLG GLILNVAGKV TANYWLSHVY APEIGEAHRS GDIHIHDLDM       180
     LSGYCAGWSL RTLLHEGLNG VPGKVEAGPP KHMSSAVGQI VNFLGTLQNE WAGAQAFSSF       240
     DTYMAPFVRK DAMDYAAVRQ CIQELVYNLN VPSRWGTQTP FTNLTFDWTC PEDLREQVPV       300
     IGGEEMPSSY GELQAEMDLI NRAYIDVMTT GDAKGRVFTF PIPTYNITPD FPWESENAAA       360
     LFDMTAKYGL PYFQNFINSE LSPNMVRSMC CRLQLDLREL LKRGNGLFGS AEQTGSLGVV       420
     TVNCARLGYL HAGDEASLFA ALDRLLELGK QSLEVKRKLI QRLMDQGLFP YTKRYLGTLR       480
     NHFSTLGVNG INEMIRNFTA DAHDITSEWG HAFAVRLLDH VRARMTAFQE ETGHLYNLEA       540
     TPAEGTTYRF AKEDKKRWPA ILQAGTAEQP YYTNSSQLPV GFTDDPFEAL QRQEALQGKY       600
     TGGTVLHLYM GERISSGAAC RELVKRALTN FRLPYITVTP TFSICPTHGY LAGEHPFCPT       660
     CDEERLEAKR RRLLAA                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page