(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE125

ALDEN1_2.PE125       Location/Qualifiers
FT   CDS             complement(136106..139408)
FT                   /locus_tag="Alide_0126"
FT                   /gene_family="HOG000224109" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; KEGG:
FT                   ajs:Ajs_0088 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="GI:319760863"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:10102149"
FT                   /translation="MMHPTHRTELRKSLYWLAGLLAGLLLVQLFPAPDAARGLARYLPL
FT                   HTSMEVLSIAMAAMVFGIAWATQKYRPNGRDLVLGPGLLGVAILDMSHCLSYAGMPDFI
FT                   TPNGPEKAILFWLAARSLAALALLCAAFWPQRHDNRLGPRARCWSLACVLLFVGAVHYV
FT                   VLLHPQSVPPTFIPGVGLTKFKIDFEYGLIAAYVLAGMGFLTHLRQDREFGLTRLALAA
FT                   FTMAMGEFFFTLYANVTDIYNVTGHLYKIMACAFLYRGLFVETVQAPYQELQASEAQHR
FT                   AMLDTLPDLLFELNRQGVYLSVHANDASKLAAPAGQLLGRRLGEILPAQAAAACLDALA
FT                   EAERSGVARGQRFRLALPSGVHHFELAIARKANPAGREDTYLTLVRDITATVHDEQRIA
FT                   FEARLNASLLDLQHSDVQELEADFLQRGIRHVERLTHSPFAVLHFVHDGQDPELAACSA
FT                   GAAGGMPAQAEVWRQECAAQRIQNQPPPGDALLRWMSLPVQEGGRTRMLLGVANKAEDY
FT                   DRQDAQALQALAYAIWRRVVQRRQDAVILRLSEALEQSPHQVVITDVRANVLYVNRAFS
FT                   EVSGYSAQEILGKNPRMLQSGLTPRSVYEEMWRRLPQGQPWQGELVNRRKNGHIYTEIV
FT                   SLYPIRDLSGQVTHYVAHKEDITVQREAEERIQALSNFDTLTGLLNKKSFDERLALAIE
FT                   RAGASHGRLSMLWFDLDNFKLINESLGHTAGDELLVEAANRLRSCLGTQNALARYSGDA
FT                   FVAIVPQADQASVALMAQEALRLLQTATSVQGHPVSVSASAGVAVYPDDARTAGTLASA
FT                   AELAMYRVKEDGRNGLRFFAPEMQAHTQRSLELAAGLKDAARKGELFLVYQPQRALGSG
FT                   ALVGAEALLRWRHPQWGLVSPAEFIPIAEQSGAITAIDFWVVEQAAQQLRAWDAAGLPP
FT                   LVVAVNVSAAQFARPQLAEELLHILQRVDVSPQRIEVELTEAVALKHPELAETTIRRLH
FT                   DMGFKVALDDFGTGYSSMSYLKRYTIDKLKIDQSFVRELAEKTSDMAIVTAIVRMAHSL
FT                   HLSTLAEGVETAEQAALLHDCGCDEIQGYWYSRPLEPRAFEAFAKGLPQRGA"
FT                   /protein_id="YP_004124800.1"
     MMHPTHRTEL RKSLYWLAGL LAGLLLVQLF PAPDAARGLA RYLPLHTSME VLSIAMAAMV        60
     FGIAWATQKY RPNGRDLVLG PGLLGVAILD MSHCLSYAGM PDFITPNGPE KAILFWLAAR       120
     SLAALALLCA AFWPQRHDNR LGPRARCWSL ACVLLFVGAV HYVVLLHPQS VPPTFIPGVG       180
     LTKFKIDFEY GLIAAYVLAG MGFLTHLRQD REFGLTRLAL AAFTMAMGEF FFTLYANVTD       240
     IYNVTGHLYK IMACAFLYRG LFVETVQAPY QELQASEAQH RAMLDTLPDL LFELNRQGVY       300
     LSVHANDASK LAAPAGQLLG RRLGEILPAQ AAAACLDALA EAERSGVARG QRFRLALPSG       360
     VHHFELAIAR KANPAGREDT YLTLVRDITA TVHDEQRIAF EARLNASLLD LQHSDVQELE       420
     ADFLQRGIRH VERLTHSPFA VLHFVHDGQD PELAACSAGA AGGMPAQAEV WRQECAAQRI       480
     QNQPPPGDAL LRWMSLPVQE GGRTRMLLGV ANKAEDYDRQ DAQALQALAY AIWRRVVQRR       540
     QDAVILRLSE ALEQSPHQVV ITDVRANVLY VNRAFSEVSG YSAQEILGKN PRMLQSGLTP       600
     RSVYEEMWRR LPQGQPWQGE LVNRRKNGHI YTEIVSLYPI RDLSGQVTHY VAHKEDITVQ       660
     REAEERIQAL SNFDTLTGLL NKKSFDERLA LAIERAGASH GRLSMLWFDL DNFKLINESL       720
     GHTAGDELLV EAANRLRSCL GTQNALARYS GDAFVAIVPQ ADQASVALMA QEALRLLQTA       780
     TSVQGHPVSV SASAGVAVYP DDARTAGTLA SAAELAMYRV KEDGRNGLRF FAPEMQAHTQ       840
     RSLELAAGLK DAARKGELFL VYQPQRALGS GALVGAEALL RWRHPQWGLV SPAEFIPIAE       900
     QSGAITAIDF WVVEQAAQQL RAWDAAGLPP LVVAVNVSAA QFARPQLAEE LLHILQRVDV       960
     SPQRIEVELT EAVALKHPEL AETTIRRLHD MGFKVALDDF GTGYSSMSYL KRYTIDKLKI      1020
     DQSFVRELAE KTSDMAIVTA IVRMAHSLHL STLAEGVETA EQAALLHDCG CDEIQGYWYS      1080
     RPLEPRAFEA FAKGLPQRGA                                                  1100
//

If you have problems or comments...

PBIL Back to PBIL home page