(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE126

ALDEN1_2.PE126       Location/Qualifiers
FT   CDS             complement(139694..140122)
FT                   /locus_tag="Alide_0127"
FT                   /gene_family="HOG000229492" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /codon_start="1"
FT                   /product="hemerythrin hhe cation binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: dia:Dtpsy_0108 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760864"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:10102150"
FT                   /translation="MNIDRFKHDHVDILGQIDRLRQLAHAGVEGNAAAIARGIVAISST
FT                   IKLHLAVEDRLLYPALSQSGNPELARLSQRFQHDMGSIATAFMAFARRWNTAESVRGDP
FT                   QSFRREANDVLRRVYERMQRENREFYPRIEAEEAMATH"
FT                   /protein_id="YP_004124801.1"
     MNIDRFKHDH VDILGQIDRL RQLAHAGVEG NAAAIARGIV AISSTIKLHL AVEDRLLYPA        60
     LSQSGNPELA RLSQRFQHDM GSIATAFMAF ARRWNTAESV RGDPQSFRRE ANDVLRRVYE       120
     RMQRENREFY PRIEAEEAMA TH                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page