(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE127

ALDEN1_2.PE127       Location/Qualifiers
FT   CDS             complement(140192..142501)
FT                   /locus_tag="Alide_0128"
FT                   /gene_family="HOG000288072" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0109"
FT                   /codon_start="1"
FT                   /product="nitric oxide reductase large subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0109 nitric oxide reductase large
FT                   subunit"
FT                   /db_xref="GI:319760865"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="GeneID:10102151"
FT                   /translation="MGKYAKYWYTLIGVLIVTFSLLGYYGAEVYRTAPPIPGQVLVQGS
FT                   DKPLYTKDSILDGQTAWQSVGGMQLGSILGHGAYQAPDWTADWLHRELTAWLELAAQKD
FT                   YGKSFAELDAGQQAVLRDRLKTEYRTNTYDQAKDTVVISPLRAQAIAETAQYYDKLFSD
FT                   DPSLHKSRESFAMKENTLPSAERRAQMAGFFFWTAWAAATERPTDVGGGNGATYTNNWP
FT                   HEPLIGNQPTGENMVWSVMSVVIMMAGVGFLVWGWAFLRKHDEQDPVPPAHDPLSRVAL
FT                   TPSQRALGKYLFLVVALFVFQVFIGGFTAHYTLEGQKFYGIDLSQWFPYALTRTWHIQA
FT                   ALFWIATGFLAAGLFLAPVINGGKDPKYQKLGVDVLFWALVVVCVGSFIGNYLAIAHIL
FT                   PKEWSFWLGHQGYEYVDLGRLWQIGKFAGIAFWLLLMARAIFPALLAPNGQDKNLLALL
FT                   TSSVVCIGLFYGTGLFYGERTHISVMEYWRWWVVHLWVEGFFEVFATTALAFIFSTLGL
FT                   VSYRMATAASLASASLFMLGGVPGTFHHLYFAGTTTPVMAVGASFSALEVVPLVVLGHE
FT                   AWEHWRLQHKTPWMADLRWPLMCFVAVAFWNMLGAGVFGFMINPPISLYYIQGLNTTPV
FT                   HAHAALFGVYGFLALGFTLLVLRYVRPQMVFNERLMKTGFWWLNAGLVLMISTSLLPIG
FT                   LFQFHASVTHGLWYARSEEFLQQPFLETLRWIRTFGDVVFITGALCVAWQVASAVLFGA
FT                   RTPAAPSTGALAGASR"
FT                   /protein_id="YP_004124802.1"
     MGKYAKYWYT LIGVLIVTFS LLGYYGAEVY RTAPPIPGQV LVQGSDKPLY TKDSILDGQT        60
     AWQSVGGMQL GSILGHGAYQ APDWTADWLH RELTAWLELA AQKDYGKSFA ELDAGQQAVL       120
     RDRLKTEYRT NTYDQAKDTV VISPLRAQAI AETAQYYDKL FSDDPSLHKS RESFAMKENT       180
     LPSAERRAQM AGFFFWTAWA AATERPTDVG GGNGATYTNN WPHEPLIGNQ PTGENMVWSV       240
     MSVVIMMAGV GFLVWGWAFL RKHDEQDPVP PAHDPLSRVA LTPSQRALGK YLFLVVALFV       300
     FQVFIGGFTA HYTLEGQKFY GIDLSQWFPY ALTRTWHIQA ALFWIATGFL AAGLFLAPVI       360
     NGGKDPKYQK LGVDVLFWAL VVVCVGSFIG NYLAIAHILP KEWSFWLGHQ GYEYVDLGRL       420
     WQIGKFAGIA FWLLLMARAI FPALLAPNGQ DKNLLALLTS SVVCIGLFYG TGLFYGERTH       480
     ISVMEYWRWW VVHLWVEGFF EVFATTALAF IFSTLGLVSY RMATAASLAS ASLFMLGGVP       540
     GTFHHLYFAG TTTPVMAVGA SFSALEVVPL VVLGHEAWEH WRLQHKTPWM ADLRWPLMCF       600
     VAVAFWNMLG AGVFGFMINP PISLYYIQGL NTTPVHAHAA LFGVYGFLAL GFTLLVLRYV       660
     RPQMVFNERL MKTGFWWLNA GLVLMISTSL LPIGLFQFHA SVTHGLWYAR SEEFLQQPFL       720
     ETLRWIRTFG DVVFITGALC VAWQVASAVL FGARTPAAPS TGALAGASR                   769
//

If you have problems or comments...

PBIL Back to PBIL home page