(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE129

ALDEN1_2.PE129       Location/Qualifiers
FT   CDS             complement(144319..144981)
FT                   /locus_tag="Alide_0130"
FT                   /gene_family="HOG000079537" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_2843"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_2843 hypothetical protein"
FT                   /db_xref="GI:319760867"
FT                   /db_xref="InterPro:IPR014602"
FT                   /db_xref="GeneID:10102153"
FT                   /translation="MENFPQDIYTEPEPDADTLANLGPLTGMAGIWTGTRGLDVNPKAD
FT                   GPERQAFIEHMELQPIDAQTNGPQLFYGLRYHTRIVKPDGVETFHDQVGYWLWEPATGT
FT                   VIQTLSIPRGQAAMAVGHAEAGARTFRLQAVRGSTVNGIVSNTFLEHAFRTESYTITVS
FT                   IHDDGTWSYEQDTVLIIPGQAEPFHHTDRNTLRKIGEPVPNPTARAAARTPGDAQGR"
FT                   /protein_id="YP_004124804.1"
     MENFPQDIYT EPEPDADTLA NLGPLTGMAG IWTGTRGLDV NPKADGPERQ AFIEHMELQP        60
     IDAQTNGPQL FYGLRYHTRI VKPDGVETFH DQVGYWLWEP ATGTVIQTLS IPRGQAAMAV       120
     GHAEAGARTF RLQAVRGSTV NGIVSNTFLE HAFRTESYTI TVSIHDDGTW SYEQDTVLII       180
     PGQAEPFHHT DRNTLRKIGE PVPNPTARAA ARTPGDAQGR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page