(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE130

ALDEN1_2.PE130       Location/Qualifiers
FT   CDS             145218..146606
FT                   /locus_tag="Alide_0131"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.17"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG:
FT                   dia:Dtpsy_0112 L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="GI:319760868"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="GeneID:10102154"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAARLFVQRLAREGHLPRVAR
FT                   VRCTLYGSLGATGRGHGSDRAVLLGLCGHAPDTVDVDAIEPLIARIRARHRLPLADGPE
FT                   VAFDEAADLLLVPDVALPLHANGMRFEAFDAAGGLLDAQVYYSVGGGFIVSGEAAVDAR
FT                   RQAEIAPDTEVLPLPFHSGEQLLAQAAAQGGSMARVMRVNERHWRTDSEIDAGLLAIWG
FT                   AMQDCVARGCRTGGVLPGGFRVRRRAPALHQALQGAPDTLQDPLQVIDWVNLFALAVNE
FT                   ENAAGGRVVTAPTNGAAGIVPAVLHYYWRFIAGASEAGVIDFLLTAGAIGILYKENASI
FT                   SGAEVGCQGEVGVACSMAAAGLCAVLGGMPAQVENAAEIGMEHHLGLTCDPVGGLVQIP
FT                   CIERNALAAVKAINAARMALRGDGTHHVSLDQVIKTMRETGADMMSKYKETSRGGLAVN
FT                   IVEC"
FT                   /product="l-serine dehydratase 1"
FT                   /protein_id="YP_004124805.1"
     MAVSVFDLFK IGIGPSSSHT VGPMRAARLF VQRLAREGHL PRVARVRCTL YGSLGATGRG        60
     HGSDRAVLLG LCGHAPDTVD VDAIEPLIAR IRARHRLPLA DGPEVAFDEA ADLLLVPDVA       120
     LPLHANGMRF EAFDAAGGLL DAQVYYSVGG GFIVSGEAAV DARRQAEIAP DTEVLPLPFH       180
     SGEQLLAQAA AQGGSMARVM RVNERHWRTD SEIDAGLLAI WGAMQDCVAR GCRTGGVLPG       240
     GFRVRRRAPA LHQALQGAPD TLQDPLQVID WVNLFALAVN EENAAGGRVV TAPTNGAAGI       300
     VPAVLHYYWR FIAGASEAGV IDFLLTAGAI GILYKENASI SGAEVGCQGE VGVACSMAAA       360
     GLCAVLGGMP AQVENAAEIG MEHHLGLTCD PVGGLVQIPC IERNALAAVK AINAARMALR       420
     GDGTHHVSLD QVIKTMRETG ADMMSKYKET SRGGLAVNIV EC                          462
//

If you have problems or comments...

PBIL Back to PBIL home page