(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE132

ALDEN1_2.PE132       Location/Qualifiers
FT   CDS             147693..149267
FT                   /locus_tag="Alide_0133"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="amp-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ajs:Ajs_0098 AMP-dependent synthetase and ligase"
FT                   /db_xref="GI:319760870"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102156"
FT                   /translation="MPMQADIEHLLAQPFGSLPELIARQAAHRPGHTALILEERSLDYA
FT                   ALCAGMDRVARSLQQGGLGPGDVVAVCAGTSVEYLLAYLGALRAGVAVAPLAPSATAEH
FT                   LSAMLDNCGARLVLRDREVAAQWPLHAGAVLRCVALDDAPEAGEPWSQWLAQGGGAPAP
FT                   IAPAPDWAFNVIYSSGTTGVPKGIVQSWAMRWAHVRRAVTNGYGPDAVSLCATPLYSNT
FT                   TLVAALPTLALGGTLVLMRKFDAAHYLELAERHGATHTMLVPVQYQRLMACPAFDGTDL
FT                   SRLRHKFCTSAPFGAALKAEVLRRWPGRLIEYYGLTEGGVRCELHCHDFPHKLHTVGRP
FT                   GEGADIRFIDEQGRELPPGAQGEIVGRSAGMMSGYHRLPDKTREAEWFDAQGQRFIRSG
FT                   DVGRLDEDGFIVLGDRMKDMIITGGFNVYPSDIEGVLQQHPQVAECAVVGVPSEQWGET
FT                   PVAYVVPRAGAQPGARELREWLNARVGKTQRVADLRLAERLPRSEIGKVLKRELREQYL
FT                   RANPAAH"
FT                   /protein_id="YP_004124807.1"
     MPMQADIEHL LAQPFGSLPE LIARQAAHRP GHTALILEER SLDYAALCAG MDRVARSLQQ        60
     GGLGPGDVVA VCAGTSVEYL LAYLGALRAG VAVAPLAPSA TAEHLSAMLD NCGARLVLRD       120
     REVAAQWPLH AGAVLRCVAL DDAPEAGEPW SQWLAQGGGA PAPIAPAPDW AFNVIYSSGT       180
     TGVPKGIVQS WAMRWAHVRR AVTNGYGPDA VSLCATPLYS NTTLVAALPT LALGGTLVLM       240
     RKFDAAHYLE LAERHGATHT MLVPVQYQRL MACPAFDGTD LSRLRHKFCT SAPFGAALKA       300
     EVLRRWPGRL IEYYGLTEGG VRCELHCHDF PHKLHTVGRP GEGADIRFID EQGRELPPGA       360
     QGEIVGRSAG MMSGYHRLPD KTREAEWFDA QGQRFIRSGD VGRLDEDGFI VLGDRMKDMI       420
     ITGGFNVYPS DIEGVLQQHP QVAECAVVGV PSEQWGETPV AYVVPRAGAQ PGARELREWL       480
     NARVGKTQRV ADLRLAERLP RSEIGKVLKR ELREQYLRAN PAAH                        524
//

If you have problems or comments...

PBIL Back to PBIL home page