(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE133

ALDEN1_2.PE133       Location/Qualifiers
FT   CDS             149285..150277
FT                   /locus_tag="Alide_0134"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0099"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0099 hypothetical protein"
FT                   /db_xref="GI:319760871"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102157"
FT                   /translation="MPIRPSRPRRAMLAGLALGAGALLAPAAQAADAWPAKPIQLVIPY
FT                   PPGGSADLLGRPLAVQLQQQLGQPVVLEYKPGAGGTLATQYLARAKPDGYTVLMVLAAH
FT                   AINDSLYPKLPYDTRKDFAPVSLVANLPMVVAASAKLQARNIQELVQAAKAAPGKLTFG
FT                   SAGNGNTGHLAAEYFSSIAGVKMTHVPYKGSAGVVNAMLAGDIDLTFDSISTSMPHIRS
FT                   GRMHALAVTSAQRSALAPEVATVQEQGIPGFEVTGWYALIAPAGTPPDIRQRLAREIAA
FT                   ALRQPQLQSQLAAGGYEPVGSTPEALQAHIDSEIARWAAVVKSTGAKVD"
FT                   /protein_id="YP_004124808.1"
     MPIRPSRPRR AMLAGLALGA GALLAPAAQA ADAWPAKPIQ LVIPYPPGGS ADLLGRPLAV        60
     QLQQQLGQPV VLEYKPGAGG TLATQYLARA KPDGYTVLMV LAAHAINDSL YPKLPYDTRK       120
     DFAPVSLVAN LPMVVAASAK LQARNIQELV QAAKAAPGKL TFGSAGNGNT GHLAAEYFSS       180
     IAGVKMTHVP YKGSAGVVNA MLAGDIDLTF DSISTSMPHI RSGRMHALAV TSAQRSALAP       240
     EVATVQEQGI PGFEVTGWYA LIAPAGTPPD IRQRLAREIA AALRQPQLQS QLAAGGYEPV       300
     GSTPEALQAH IDSEIARWAA VVKSTGAKVD                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page