(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE134

ALDEN1_2.PE134       Location/Qualifiers
FT   CDS             150290..150745
FT                   /locus_tag="Alide_0135"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dia:Dtpsy_0117 thioesterase superfamily protein"
FT                   /db_xref="GI:319760872"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102158"
FT                   /translation="MQHHSIAINDIPPSPFAGEPPDMFFGLPMAMARAMALRGERIGND
FT                   MAQVRLGFQPDQANSRGDVHGGSIATLLDCTLAAAVRSHDPAAYGVATIDLTLHFVTAA
FT                   GGDLIATAHCERRGRSISFARGEVRAEDGTLVALATGSFKLIARRQD"
FT                   /protein_id="YP_004124809.1"
     MQHHSIAIND IPPSPFAGEP PDMFFGLPMA MARAMALRGE RIGNDMAQVR LGFQPDQANS        60
     RGDVHGGSIA TLLDCTLAAA VRSHDPAAYG VATIDLTLHF VTAAGGDLIA TAHCERRGRS       120
     ISFARGEVRA EDGTLVALAT GSFKLIARRQ D                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page