(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE135

ALDEN1_2.PE135       Location/Qualifiers
FT   CDS             complement(150767..151777)
FT                   /locus_tag="Alide_0136"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0118"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0118 hypothetical protein"
FT                   /db_xref="GI:319760873"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102159"
FT                   /translation="MAHDTPLARCSRRQLLAMAAGAAAAGPLHAQAQAGFATRPVRVVV
FT                   PFAAGGATDVITRVLGEHMARRFGQPVVVDNKPGAAGLIAGEAVVKSAPDGMTALLGTT
FT                   STMLTNKYLYQKTAYDPLTDLTPLVRVCLAPIALVVSADVPARNMQEFMAWIRANKGRL
FT                   SYGSYGIGSHGQLACATLSDIAGADMSHVAYKGEAPMVQDLLGGQIKMGMGSLLSLKAH
FT                   IDAGKLRALAMTGPRRVPLLPDVPTFAEAGYPQDALALVGWLAIAGPKGMPAQVARQWA
FT                   EAANQAVASRDGMARIIAAGFVPVDDDTPEKFARLWAQEAPIWGRLLQAAGVQPT"
FT                   /protein_id="YP_004124810.1"
     MAHDTPLARC SRRQLLAMAA GAAAAGPLHA QAQAGFATRP VRVVVPFAAG GATDVITRVL        60
     GEHMARRFGQ PVVVDNKPGA AGLIAGEAVV KSAPDGMTAL LGTTSTMLTN KYLYQKTAYD       120
     PLTDLTPLVR VCLAPIALVV SADVPARNMQ EFMAWIRANK GRLSYGSYGI GSHGQLACAT       180
     LSDIAGADMS HVAYKGEAPM VQDLLGGQIK MGMGSLLSLK AHIDAGKLRA LAMTGPRRVP       240
     LLPDVPTFAE AGYPQDALAL VGWLAIAGPK GMPAQVARQW AEAANQAVAS RDGMARIIAA       300
     GFVPVDDDTP EKFARLWAQE APIWGRLLQA AGVQPT                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page