(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE136

ALDEN1_2.PE136       Location/Qualifiers
FT   CDS             complement(151817..152803)
FT                   /locus_tag="Alide_0137"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0119"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0119 hypothetical protein"
FT                   /db_xref="GI:319760874"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102160"
FT                   /translation="MAITRRKTLARCLPLIALAAACGMGGAQAQDSYPSKPIRVIVPYP
FT                   AGGGTDTIARLIGTQLSQLLGQPVVVENKPGASGILGNDIVAKAPGDGYTVLMGITALV
FT                   QIPALYKKVPYKLGDLAPVSQIAKSADLLMVPRSSGVTTLQQFVDKAKAAPGTLNYGSY
FT                   GNATSSHMNGERFKQKAGIDITHIPYQGSGPEMAALLGGQLTLAFVDATGAYPHIKSDK
FT                   VNILAITGSQRHPALPQVPTMTESGYPGLEANGWFGMFVPASTPKAIVDKLGAEVASIV
FT                   KSPELNKRLTDMGLIAVGSLPDDFKAQVDKDAAHWKSVAESARISMD"
FT                   /protein_id="YP_004124811.1"
     MAITRRKTLA RCLPLIALAA ACGMGGAQAQ DSYPSKPIRV IVPYPAGGGT DTIARLIGTQ        60
     LSQLLGQPVV VENKPGASGI LGNDIVAKAP GDGYTVLMGI TALVQIPALY KKVPYKLGDL       120
     APVSQIAKSA DLLMVPRSSG VTTLQQFVDK AKAAPGTLNY GSYGNATSSH MNGERFKQKA       180
     GIDITHIPYQ GSGPEMAALL GGQLTLAFVD ATGAYPHIKS DKVNILAITG SQRHPALPQV       240
     PTMTESGYPG LEANGWFGMF VPASTPKAIV DKLGAEVASI VKSPELNKRL TDMGLIAVGS       300
     LPDDFKAQVD KDAAHWKSVA ESARISMD                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page