(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE14

ALDEN1_2.PE14        Location/Qualifiers
FT   CDS             17232..17516
FT                   /locus_tag="Alide_0014"
FT                   /gene_family="HOG000044611" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_4153"
FT                   /codon_start="1"
FT                   /product="4fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_4153 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="GI:319760752"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:10102037"
FT                   /translation="MLSPMHAPRKALPAIDPDRCTGCGWCVAACPPHVLSLQVQGMERF
FT                   GAKRSVLHDAPGCTGCALCALRCPFDAIRMVRTTARRGEHGQDIEAKVD"
FT                   /protein_id="YP_004124689.1"
     MLSPMHAPRK ALPAIDPDRC TGCGWCVAAC PPHVLSLQVQ GMERFGAKRS VLHDAPGCTG        60
     CALCALRCPF DAIRMVRTTA RRGEHGQDIE AKVD                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page