(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE141

ALDEN1_2.PE141       Location/Qualifiers
FT   CDS             157889..158887
FT                   /locus_tag="Alide_0142"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0125"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="GI:319760879"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102165"
FT                   /translation="MPPCNRRRALHLTGACALLALGALATAPAARADAAWPTRPITFVI
FT                   PGAAGGTTDTPARFMAQKLGERLGQPIVVDNKPGAGGMLGAGLVARAQPDGYTVLVGNT
FT                   GSNAINYSAYQKLGYKPDDFIALTDMISFANVLVVPVKSPIKSLGELVAAAKKEPGKLA
FT                   FSSAGVGQTTHLMGELLRQRAGVDVVHVPYKGSAPATMAIVSGETQFMFDNLTGSLAHV
FT                   KDGKLRALAVTGATREPELPDVPTMTELGMRDFDKVGWMGFFLPAKTPPEIVKKLTDNL
FT                   VAVLKDPAVVQRYRELGGRPGGMASAQFSQMVERDRKDWGELIRSQKLQLD"
FT                   /protein_id="YP_004124816.1"
     MPPCNRRRAL HLTGACALLA LGALATAPAA RADAAWPTRP ITFVIPGAAG GTTDTPARFM        60
     AQKLGERLGQ PIVVDNKPGA GGMLGAGLVA RAQPDGYTVL VGNTGSNAIN YSAYQKLGYK       120
     PDDFIALTDM ISFANVLVVP VKSPIKSLGE LVAAAKKEPG KLAFSSAGVG QTTHLMGELL       180
     RQRAGVDVVH VPYKGSAPAT MAIVSGETQF MFDNLTGSLA HVKDGKLRAL AVTGATREPE       240
     LPDVPTMTEL GMRDFDKVGW MGFFLPAKTP PEIVKKLTDN LVAVLKDPAV VQRYRELGGR       300
     PGGMASAQFS QMVERDRKDW GELIRSQKLQ LD                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page