(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE142

ALDEN1_2.PE142       Location/Qualifiers
FT   CDS             158897..159703
FT                   /locus_tag="Alide_0143"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ajs:Ajs_0109 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760880"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102166"
FT                   /translation="MTDTSSFAGRHVFVAGGSSGINLGIAQAFARAGAHVTVMSRSPDK
FT                   VQQAAEGLRALGAQALGISADVRDSAAVDAALRQSHALFGDIDVLVSGAAGNFIAPAKD
FT                   LSPNGFRTVIDIDLNGSFHVLRLAYPLLRKPGASVINISAPQGVNPTMYQVHACAAKAG
FT                   IDMMTRVLAMEWGEDGVRVNAIAPGPIADTEGMRRLAPSPEALANAVASVPLQRMGTLE
FT                   DIAHMALFLSSPQAGYVTGAVIPVDGGSSLRGGRDMRASYTPRGAA"
FT                   /protein_id="YP_004124817.1"
     MTDTSSFAGR HVFVAGGSSG INLGIAQAFA RAGAHVTVMS RSPDKVQQAA EGLRALGAQA        60
     LGISADVRDS AAVDAALRQS HALFGDIDVL VSGAAGNFIA PAKDLSPNGF RTVIDIDLNG       120
     SFHVLRLAYP LLRKPGASVI NISAPQGVNP TMYQVHACAA KAGIDMMTRV LAMEWGEDGV       180
     RVNAIAPGPI ADTEGMRRLA PSPEALANAV ASVPLQRMGT LEDIAHMALF LSSPQAGYVT       240
     GAVIPVDGGS SLRGGRDMRA SYTPRGAA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page