(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE144

ALDEN1_2.PE144       Location/Qualifiers
FT   CDS             159841..160620
FT                   /locus_tag="Alide_0145"
FT                   /gene_family="HOG000256786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0128 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760882"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102168"
FT                   /translation="MNTDADGKLVSALVRGISILRCFGHKRTELSARELMELTGLPKPT
FT                   LFRLTDTLCELGLLRYSERLSKYVPGLGLLQLSSPVLTRMALRQFARPLMQSLADLTEG
FT                   QVQLGVGHKRELCLVELANGMGNSVYRPEIGVRMSLSRTATGRAYLLGMADDAREAYLQ
FT                   DLQASDPQRAAWLAQRLVNAREDMERHGFCRSHGDLHSEIESIAVPMSQPQDGELWIFA
FT                   VSVPVFSPLYDRLESDLGPRLRTLVRSVEAVVGAGVP"
FT                   /protein_id="YP_004124819.1"
     MNTDADGKLV SALVRGISIL RCFGHKRTEL SARELMELTG LPKPTLFRLT DTLCELGLLR        60
     YSERLSKYVP GLGLLQLSSP VLTRMALRQF ARPLMQSLAD LTEGQVQLGV GHKRELCLVE       120
     LANGMGNSVY RPEIGVRMSL SRTATGRAYL LGMADDAREA YLQDLQASDP QRAAWLAQRL       180
     VNAREDMERH GFCRSHGDLH SEIESIAVPM SQPQDGELWI FAVSVPVFSP LYDRLESDLG       240
     PRLRTLVRSV EAVVGAGVP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page