(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE145

ALDEN1_2.PE145       Location/Qualifiers
FT   CDS             160715..161824
FT                   /locus_tag="Alide_0146"
FT                   /gene_family="HOG000219744" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: ajs:Ajs_0112 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760883"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102169"
FT                   /translation="MKVLDSVRVLEIGGLGPGPFCAMHLADLGADVISVVRKDQGGSPT
FT                   GSLLNRGKRSVFADLKTEEGRRLVLALVQDADALIEGMRPGVMERLGLGPEECLALNPR
FT                   LVYGRMTGWGQSGPLAPRAGHDANYAAVSGALWGSSPADARPVSPFAVLGDIAGGAMYL
FT                   MTGLLSGILQARATGRGTVVDAAIVDGAAHMLNLNLSARQRGVVADERGHSMYDSSPFY
FT                   ETYVCADGKHVTLGAIEPQFYALLLATLGLAGDPDFAGDQWDKAAWPARRARLAALFLT
FT                   QPRAHWQALLEPTDVCFGAVLSPVEAAEHPHMRARGVYTERAGVLQAMPAPRFDGAPYL
FT                   PGDGCAPGAHTAQVLAQLAGQGAKAVWRR"
FT                   /protein_id="YP_004124820.1"
     MKVLDSVRVL EIGGLGPGPF CAMHLADLGA DVISVVRKDQ GGSPTGSLLN RGKRSVFADL        60
     KTEEGRRLVL ALVQDADALI EGMRPGVMER LGLGPEECLA LNPRLVYGRM TGWGQSGPLA       120
     PRAGHDANYA AVSGALWGSS PADARPVSPF AVLGDIAGGA MYLMTGLLSG ILQARATGRG       180
     TVVDAAIVDG AAHMLNLNLS ARQRGVVADE RGHSMYDSSP FYETYVCADG KHVTLGAIEP       240
     QFYALLLATL GLAGDPDFAG DQWDKAAWPA RRARLAALFL TQPRAHWQAL LEPTDVCFGA       300
     VLSPVEAAEH PHMRARGVYT ERAGVLQAMP APRFDGAPYL PGDGCAPGAH TAQVLAQLAG       360
     QGAKAVWRR                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page