(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE146

ALDEN1_2.PE146       Location/Qualifiers
FT   CDS             complement(161850..162839)
FT                   /locus_tag="Alide_0147"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_B1448"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_B1448 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760884"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102170"
FT                   /translation="MSHPFCHIVPLRRRSVLLGGAALLGMLSSPAWSQEVARIYVGFAA
FT                   GGVTDLAARLLAPALSAELGQTFIVENRPGASSALAIKAVEGSAPASHTFVLYPTLALL
FT                   GFLLNGQQPALDRITPISLLYEQFAVLAINPQVAGLENVRTLQDLLQVAKAKAGTLTYT
FT                   SSGVGSTGHLAMEWVCSLAGVKMQHVPYKGGAPAVTDVLGGHVGTIFADSTIIAPHVKS
FT                   GKVRALAINYPVRVPGFAEVPTVAEQGFKEVSAVPWVVLAGPPGMSDAAADRMAAAVSR
FT                   VLAKPDIAQSMQEQNMVPRHSTPRETRQLMQRDMLAWRKIIEDNGIKL"
FT                   /protein_id="YP_004124821.1"
     MSHPFCHIVP LRRRSVLLGG AALLGMLSSP AWSQEVARIY VGFAAGGVTD LAARLLAPAL        60
     SAELGQTFIV ENRPGASSAL AIKAVEGSAP ASHTFVLYPT LALLGFLLNG QQPALDRITP       120
     ISLLYEQFAV LAINPQVAGL ENVRTLQDLL QVAKAKAGTL TYTSSGVGST GHLAMEWVCS       180
     LAGVKMQHVP YKGGAPAVTD VLGGHVGTIF ADSTIIAPHV KSGKVRALAI NYPVRVPGFA       240
     EVPTVAEQGF KEVSAVPWVV LAGPPGMSDA AADRMAAAVS RVLAKPDIAQ SMQEQNMVPR       300
     HSTPRETRQL MQRDMLAWRK IIEDNGIKL                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page