(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE148

ALDEN1_2.PE148       Location/Qualifiers
FT   CDS             complement(163301..164461)
FT                   /locus_tag="Alide_0149"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2148"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2148 acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:319760886"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102172"
FT                   /translation="MNPSLSKSVAIVGVAESDLGKVPGKSALELQAQAAMLALADAGLK
FT                   LSDVDGVFAHTDDRFSSLQVSEFLGLRPRFVDSTNVGGMSNLLHVQRAMAAIAAGMCEV
FT                   ALITYGSTQLSDGSRKGGAVAADVPHTPRGQFILPYGHLSPIGYYAMVAQLHMHRYGTT
FT                   PKDLAEVAVAARRWAQLNPKAYRREPTSIDEVMASPLVAEPLRQRDCCLVTDGGGAMVV
FT                   VSAGRARDLRQKPVYVLGAAETHAHHYTPFNTGDWLDTGVASTAEAALRMAGVTRADID
FT                   VVQIYDHFTIGVIQSLEELGFCKRGEGGAFVADGALAPGGRLPVNTSGGGLSYGHPGMF
FT                   GMFVAIEAVRQLRGECGERQLPKAELALCHAPGLVFSCNTTMILGV"
FT                   /protein_id="YP_004124823.1"
     MNPSLSKSVA IVGVAESDLG KVPGKSALEL QAQAAMLALA DAGLKLSDVD GVFAHTDDRF        60
     SSLQVSEFLG LRPRFVDSTN VGGMSNLLHV QRAMAAIAAG MCEVALITYG STQLSDGSRK       120
     GGAVAADVPH TPRGQFILPY GHLSPIGYYA MVAQLHMHRY GTTPKDLAEV AVAARRWAQL       180
     NPKAYRREPT SIDEVMASPL VAEPLRQRDC CLVTDGGGAM VVVSAGRARD LRQKPVYVLG       240
     AAETHAHHYT PFNTGDWLDT GVASTAEAAL RMAGVTRADI DVVQIYDHFT IGVIQSLEEL       300
     GFCKRGEGGA FVADGALAPG GRLPVNTSGG GLSYGHPGMF GMFVAIEAVR QLRGECGERQ       360
     LPKAELALCH APGLVFSCNT TMILGV                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page