(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE15

ALDEN1_2.PE15        Location/Qualifiers
FT   CDS             17834..19219
FT                   /locus_tag="Alide_0015"
FT                   /gene_family="HOG000076615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /codon_start="1"
FT                   /product="homoserine dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: ajs:Ajs_4155 homoserine
FT                   dehydrogenase"
FT                   /db_xref="GI:319760753"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="GeneID:10102038"
FT                   /translation="MFLEPQPSLLPETRAHAPATPPALRVGMIGMGTVGAGVWRVLRRN
FT                   QALIAARAGRPIDIVAVAARTPARAAAVLEGAPGVRLLADPMRLATDPGVDVVLELAGG
FT                   SGAARGWVLAALAHGKHVVTANKALLAEHGEELATVAARHGRTLAYEAAVAGGVPVVKA
FT                   LREGLAANRIHALAGVLNGTSNYILTRMQAGGLDLAAALAEAQALGYAEADPALDVDGT
FT                   DAAHKLALLAANAFGMPVRLDAVHVEGLRGLRQGDVAAAAQLGYAVRLLAIARRGAEGV
FT                   ELRVHPALVPERHALARLSGAANGLLVQGDAAGEAFYGGAGAGGEPTASAVLADLVDLA
FT                   RLPAGAHARAGVPTLGVHSRAAEQPAPLPMAQVRTRHFLRLLPGAALNEAEALRLLARA
FT                   GLSVQRRAWGPAPEGGAAPTLLLLTAPAPDAVAAHAAARLHERTGAIVRRLRVEDFSSS
FT                   EYA"
FT                   /protein_id="YP_004124690.1"
     MFLEPQPSLL PETRAHAPAT PPALRVGMIG MGTVGAGVWR VLRRNQALIA ARAGRPIDIV        60
     AVAARTPARA AAVLEGAPGV RLLADPMRLA TDPGVDVVLE LAGGSGAARG WVLAALAHGK       120
     HVVTANKALL AEHGEELATV AARHGRTLAY EAAVAGGVPV VKALREGLAA NRIHALAGVL       180
     NGTSNYILTR MQAGGLDLAA ALAEAQALGY AEADPALDVD GTDAAHKLAL LAANAFGMPV       240
     RLDAVHVEGL RGLRQGDVAA AAQLGYAVRL LAIARRGAEG VELRVHPALV PERHALARLS       300
     GAANGLLVQG DAAGEAFYGG AGAGGEPTAS AVLADLVDLA RLPAGAHARA GVPTLGVHSR       360
     AAEQPAPLPM AQVRTRHFLR LLPGAALNEA EALRLLARAG LSVQRRAWGP APEGGAAPTL       420
     LLLTAPAPDA VAAHAAARLH ERTGAIVRRL RVEDFSSSEY A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page