(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE151

ALDEN1_2.PE151       Location/Qualifiers
FT   CDS             complement(167204..168139)
FT                   /locus_tag="Alide_0152"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.107"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.107"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2151 acyl dehydratase; PFAM: MaoC
FT                   domain protein dehydratase"
FT                   /db_xref="GI:319760889"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102175"
FT                   /translation="MAIDYDTLRQWQIADQRDRYGADDCIRYALSLGMGADPLDEADLR
FT                   YVLEGENMSVMPTWLACVGAPGAWASDPGTGIDWMQILHGEHRMRFHAPPPPEGEVLSQ
FT                   TRISRVVDKGAGKGALVVTERRASNAATGQLLATVEHVSFCRADGGFSSPAQPGDCAPQ
FT                   ALPAVPEREPDATMDMATLPGAALLYRLNGDRNPIHAQPGAARAAGFDRPILHGLCTFG
FT                   MAARALVRMACGNDPARLASIAARFSAPVFPGDTLQARLWFERDGDARQARFSVWARER
FT                   GRMVLSHGVADIRKPLASAGTARGQAHVTA"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-coahydratase"
FT                   /protein_id="YP_004124826.1"
     MAIDYDTLRQ WQIADQRDRY GADDCIRYAL SLGMGADPLD EADLRYVLEG ENMSVMPTWL        60
     ACVGAPGAWA SDPGTGIDWM QILHGEHRMR FHAPPPPEGE VLSQTRISRV VDKGAGKGAL       120
     VVTERRASNA ATGQLLATVE HVSFCRADGG FSSPAQPGDC APQALPAVPE REPDATMDMA       180
     TLPGAALLYR LNGDRNPIHA QPGAARAAGF DRPILHGLCT FGMAARALVR MACGNDPARL       240
     ASIAARFSAP VFPGDTLQAR LWFERDGDAR QARFSVWARE RGRMVLSHGV ADIRKPLASA       300
     GTARGQAHVT A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page