(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE153

ALDEN1_2.PE153       Location/Qualifiers
FT   CDS             complement(169106..170089)
FT                   /locus_tag="Alide_0154"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:H16_A2153"
FT                   /codon_start="1"
FT                   /product="extra-cytoplasmic solute receptor"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2153 extra-cytoplasmic solute
FT                   receptor"
FT                   /db_xref="GI:319760891"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102177"
FT                   /translation="MWSRIFQMGAPVIAAVSLALPLSAHSQGEVFKASKPMHIVAPSSP
FT                   GGILDQTSRLVAKALTDIVGQPVIVDNHPGAGGTIGIQTMLRAEPDGHTLVMGSLGPNA
FT                   ANYTLQDKLPYTAADMTGVIRVLTMPDVVVVNPKLPVKSIAELKAYAQNSPNGVSMAVS
FT                   TSGSSGHLAGAMLNQRAGIKAVEVVYRGASPALTDLVGGQVDYMVDNLITALPLVRSGK
FT                   LRAIAVTTRERSAELPDVPTLMELGYKDFDVSVWLGLFVSSKTPAATVQALNAALNKAL
FT                   SDPQVQKTIAQQGGSATGGSTEEFAQFVRNETTRWAEVIRAGNIKP"
FT                   /protein_id="YP_004124828.1"
     MWSRIFQMGA PVIAAVSLAL PLSAHSQGEV FKASKPMHIV APSSPGGILD QTSRLVAKAL        60
     TDIVGQPVIV DNHPGAGGTI GIQTMLRAEP DGHTLVMGSL GPNAANYTLQ DKLPYTAADM       120
     TGVIRVLTMP DVVVVNPKLP VKSIAELKAY AQNSPNGVSM AVSTSGSSGH LAGAMLNQRA       180
     GIKAVEVVYR GASPALTDLV GGQVDYMVDN LITALPLVRS GKLRAIAVTT RERSAELPDV       240
     PTLMELGYKD FDVSVWLGLF VSSKTPAATV QALNAALNKA LSDPQVQKTI AQQGGSATGG       300
     STEEFAQFVR NETTRWAEVI RAGNIKP                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page