(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE154

ALDEN1_2.PE154       Location/Qualifiers
FT   CDS             170319..171104
FT                   /locus_tag="Alide_0155"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A2154 IclR family transcriptional
FT                   regulator; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760892"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102178"
FT                   /translation="MATPDSEGFVRSFARGLRVIEAMGRTGAHTVSSVAQDTELPRTVA
FT                   RRILLTLCELGYACPTPDKGFRLTPKVLSLGLTYLTSQPFWGHAQRVLETVCLQLRESC
FT                   AVAVMQGNEVVFVLRIPSAKVMSPHLGMGSRLPAYATAPGRVLLAYQGAGYQDQYFGQT
FT                   PLRPLTGQTQTDPAELRHELARIAQQGHAWVEGEYDAHVSGLSLPIYDERRKVVAALGA
FT                   SLLTSDFDRARAEREILPPLRAAAEQLSGLAPSFLAPVL"
FT                   /protein_id="YP_004124829.1"
     MATPDSEGFV RSFARGLRVI EAMGRTGAHT VSSVAQDTEL PRTVARRILL TLCELGYACP        60
     TPDKGFRLTP KVLSLGLTYL TSQPFWGHAQ RVLETVCLQL RESCAVAVMQ GNEVVFVLRI       120
     PSAKVMSPHL GMGSRLPAYA TAPGRVLLAY QGAGYQDQYF GQTPLRPLTG QTQTDPAELR       180
     HELARIAQQG HAWVEGEYDA HVSGLSLPIY DERRKVVAAL GASLLTSDFD RARAEREILP       240
     PLRAAAEQLS GLAPSFLAPV L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page