(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE155

ALDEN1_2.PE155       Location/Qualifiers
FT   CDS             complement(171124..172380)
FT                   /locus_tag="Alide_0156"
FT                   /gene_family="HOG000225587" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily mfs_1"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0113 major facilitator superfamily
FT                   transporter; manually curated; PFAM: major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="GI:319760893"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:10102179"
FT                   /translation="MPQFPVTVPASTSTHSRAQPLWVMLLALLSGFALSQSYRTITAIV
FT                   AQGLQADFGLSAQSLGAFAGLFGLSFGVAQLLMGITMDRYGLRRTVLASAPLSIAGAAL
FT                   SALAPSHGWLMAGQLLIGIGCSPAFLACTVFIARHFPSERFAFFSGLSLGMGGLGLMLT
FT                   GTPLAWVVQHWGWRTGFGILAVLSALSWLLIFALVHEPSLPGRAPHAQESWGDSLRGLA
FT                   ELLTLPHTWGILALGMSCYAAFLSLRGLWLGPLLMDRFGFSLVDSGNVALVLSLISLFA
FT                   PGAFGRMDPGPLRRRAWVANASLLMAAMFAAMALLQQAGATVALMILLGLLWGFSVLQY
FT                   TDVRASYPPELTGRALSLYTMSMFLGVALMQSATGAVAAWAAGRGIEPYLAVLLAIAGW
FT                   LALASLAFRMLPASPLLRR"
FT                   /protein_id="YP_004124830.1"
     MPQFPVTVPA STSTHSRAQP LWVMLLALLS GFALSQSYRT ITAIVAQGLQ ADFGLSAQSL        60
     GAFAGLFGLS FGVAQLLMGI TMDRYGLRRT VLASAPLSIA GAALSALAPS HGWLMAGQLL       120
     IGIGCSPAFL ACTVFIARHF PSERFAFFSG LSLGMGGLGL MLTGTPLAWV VQHWGWRTGF       180
     GILAVLSALS WLLIFALVHE PSLPGRAPHA QESWGDSLRG LAELLTLPHT WGILALGMSC       240
     YAAFLSLRGL WLGPLLMDRF GFSLVDSGNV ALVLSLISLF APGAFGRMDP GPLRRRAWVA       300
     NASLLMAAMF AAMALLQQAG ATVALMILLG LLWGFSVLQY TDVRASYPPE LTGRALSLYT       360
     MSMFLGVALM QSATGAVAAW AAGRGIEPYL AVLLAIAGWL ALASLAFRML PASPLLRR         418
//

If you have problems or comments...

PBIL Back to PBIL home page