(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE156

ALDEN1_2.PE156       Location/Qualifiers
FT   CDS             complement(172421..173284)
FT                   /locus_tag="Alide_0157"
FT                   /gene_family="HOG000242281" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.3.34"
FT                   /codon_start="1"
FT                   /EC_number="4.1.3.34"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0131 HpcH/HpaI aldolase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="GI:319760894"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="GeneID:10102180"
FT                   /translation="MTDLVRNACSFLFVPATQPDRLPKALASGADMVIADWEDAVTPAD
FT                   KERARSALAGAVAALDGARRARLLVRINAEGTPWFAADLQALQQLMAQGLAGAVVPKAE
FT                   SAQTLQAVARAAGPQAALLPLVESVAGLYAVDVLAAAPQVARLAFGHLDFQVDAGMACD
FT                   PDEAELLPMRMAVVLAARRAGMAAPLDGVTVDTRNPERMASDAERARRMGFGGKLCIHP
FT                   AQVPVLHAAFDPGEAAVAHARRVQQAMQEAGGGVCVLDGRMVDAPVLAQARQTLERHAH
FT                   AQRRSA"
FT                   /product="citryl-CoA lyase"
FT                   /protein_id="YP_004124831.1"
     MTDLVRNACS FLFVPATQPD RLPKALASGA DMVIADWEDA VTPADKERAR SALAGAVAAL        60
     DGARRARLLV RINAEGTPWF AADLQALQQL MAQGLAGAVV PKAESAQTLQ AVARAAGPQA       120
     ALLPLVESVA GLYAVDVLAA APQVARLAFG HLDFQVDAGM ACDPDEAELL PMRMAVVLAA       180
     RRAGMAAPLD GVTVDTRNPE RMASDAERAR RMGFGGKLCI HPAQVPVLHA AFDPGEAAVA       240
     HARRVQQAMQ EAGGGVCVLD GRMVDAPVLA QARQTLERHA HAQRRSA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page