(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE158

ALDEN1_2.PE158       Location/Qualifiers
FT   CDS             complement(175711..177096)
FT                   /locus_tag="Alide_0160"
FT                   /gene_family="HOG000267405" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /codon_start="1"
FT                   /product="mmge/prpd family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: dia:Dtpsy_0134
FT                   MmgE/PrpD family protein"
FT                   /db_xref="GI:319760896"
FT                   /db_xref="GO:0047547"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="GeneID:10102183"
FT                   /translation="MKQEIQVSIHPLAQFAAQLQWSDVPAPVQDRAVDLWVDWFGSVLA
FT                   GCKARPVASIARFALSQGPASGPSEVIAQGASSSPMMAALANAAASHFAEQDDVHNGSV
FT                   FHPAAVVFPPALAVAQAIGASGAELMAACVAGYEVGIRVGEFLGRSHYKVFHTTATAGT
FT                   LAAAAAVGRLLQLTPAQMQHAFGSAGTQSAGLWEFLRTAADSKQLHTAHAAAAGLMAAY
FT                   LARDGFTGAQDIFTGAQGMAAGMSSDANPARLTDGLPNGGVGRWATAETSFKWHASCRH
FT                   THPAADALQQVMREHGLKPADIAQVTCHVHQGAIDVLGPVVSPTTVHQSKFSMGTVLAL
FT                   AAHFGHAGLTEFDAQFLAPDTVALREKVRMELDAEVDAAYPQRWIGKVTVQTTDGRRLH
FT                   GRVDEPKGDPGNTLSREEITAKALRLAAYGGAVGTAQATSAVASLWQVAQWPRVGDLLA
FT                   AGA"
FT                   /protein_id="YP_004124833.1"
     MKQEIQVSIH PLAQFAAQLQ WSDVPAPVQD RAVDLWVDWF GSVLAGCKAR PVASIARFAL        60
     SQGPASGPSE VIAQGASSSP MMAALANAAA SHFAEQDDVH NGSVFHPAAV VFPPALAVAQ       120
     AIGASGAELM AACVAGYEVG IRVGEFLGRS HYKVFHTTAT AGTLAAAAAV GRLLQLTPAQ       180
     MQHAFGSAGT QSAGLWEFLR TAADSKQLHT AHAAAAGLMA AYLARDGFTG AQDIFTGAQG       240
     MAAGMSSDAN PARLTDGLPN GGVGRWATAE TSFKWHASCR HTHPAADALQ QVMREHGLKP       300
     ADIAQVTCHV HQGAIDVLGP VVSPTTVHQS KFSMGTVLAL AAHFGHAGLT EFDAQFLAPD       360
     TVALREKVRM ELDAEVDAAY PQRWIGKVTV QTTDGRRLHG RVDEPKGDPG NTLSREEITA       420
     KALRLAAYGG AVGTAQATSA VASLWQVAQW PRVGDLLAAG A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page