(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE16

ALDEN1_2.PE16        Location/Qualifiers
FT   CDS             19379..21553
FT                   /locus_tag="Alide_0016"
FT                   /gene_family="HOG000242573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00491"
FT                   /codon_start="1"
FT                   /product="helicase c2"
FT                   /transl_table="11"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   ajs:Ajs_4158 ATP-dependent DNA helicase DinG"
FT                   /db_xref="GI:319760754"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="GeneID:10102039"
FT                   /translation="MSTQPWAGQALQSFEAVVQSTAGFRVREGQRRMAEQVAQTFAQAQ
FT                   LGKLEDEDSQPRRAIAVVQAGTGVGKSLAYSVPAIAMALARGTRVLISTATVALQEQLV
FT                   HKDLPALAARMEQPFQFALAKGRGRYVCKLKLERLAGGAAGGEDGVPDDDLFPEEAAAQ
FT                   RQRPRHDAEARMRFYASMADALATGGWDGDRDTLDSPPEPEAWSPVAAEASSCTGKHCP
FT                   LFSQCTYYERRKALVAAQVIVANHDLLLSSLGARLLPELDNCLLVIDEAHHLPATALQQ
FT                   FACEADLSRLTWIDKLASRALRIGQLVEVEEIADIPNHAARLRAALQDAARLVMDLYGE
FT                   QLRAPLPGRRQFSASMPTRARVQGGVLPEALAEPFSQAAHHAGGFLDALRAIAKALRGE
FT                   MRDKPDEARRLSQLYAQIGALAPRLEGVHAAAQLLLQDAPDGAVPAAKWFTLETDGDFI
FT                   VVRAHASPVLPGSTLQNHLWSAVRGAVLTSATLTGCGQFDFFLREAGLWGDDAVTTLAV
FT                   PSPFDYALQGTLVATETRAEPRDAQAFTAEMVDALLSDLALVEAGALVLFTSREQMRQA
FT                   VDLLPTAMRGAVLVQNTLPRPQLLARHRERVADGLPSIIFGMQSFGEGLDLPGRLCESL
FT                   FITKLPFAPPDDPVGEARAEWLRGAGRDPFSELVVPATAIRLAQWVGRAIRTEEDRAHV
FT                   YCYDKRLVRTGYGQRLLAGLPPFALQRRAA"
FT                   /protein_id="YP_004124691.1"
     MSTQPWAGQA LQSFEAVVQS TAGFRVREGQ RRMAEQVAQT FAQAQLGKLE DEDSQPRRAI        60
     AVVQAGTGVG KSLAYSVPAI AMALARGTRV LISTATVALQ EQLVHKDLPA LAARMEQPFQ       120
     FALAKGRGRY VCKLKLERLA GGAAGGEDGV PDDDLFPEEA AAQRQRPRHD AEARMRFYAS       180
     MADALATGGW DGDRDTLDSP PEPEAWSPVA AEASSCTGKH CPLFSQCTYY ERRKALVAAQ       240
     VIVANHDLLL SSLGARLLPE LDNCLLVIDE AHHLPATALQ QFACEADLSR LTWIDKLASR       300
     ALRIGQLVEV EEIADIPNHA ARLRAALQDA ARLVMDLYGE QLRAPLPGRR QFSASMPTRA       360
     RVQGGVLPEA LAEPFSQAAH HAGGFLDALR AIAKALRGEM RDKPDEARRL SQLYAQIGAL       420
     APRLEGVHAA AQLLLQDAPD GAVPAAKWFT LETDGDFIVV RAHASPVLPG STLQNHLWSA       480
     VRGAVLTSAT LTGCGQFDFF LREAGLWGDD AVTTLAVPSP FDYALQGTLV ATETRAEPRD       540
     AQAFTAEMVD ALLSDLALVE AGALVLFTSR EQMRQAVDLL PTAMRGAVLV QNTLPRPQLL       600
     ARHRERVADG LPSIIFGMQS FGEGLDLPGR LCESLFITKL PFAPPDDPVG EARAEWLRGA       660
     GRDPFSELVV PATAIRLAQW VGRAIRTEED RAHVYCYDKR LVRTGYGQRL LAGLPPFALQ       720
     RRAA                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page