(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE163

ALDEN1_2.PE163       Location/Qualifiers
FT   CDS             181578..182471
FT                   /locus_tag="Alide_0165"
FT                   /gene_family="HOG000044064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.107"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.107"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0121 dehydratase; PFAM: MaoC domain
FT                   protein dehydratase"
FT                   /db_xref="GI:319760901"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:10102188"
FT                   /translation="MAIDYRHLKNRAFEPVHQHYTERDTMLYALSLGLGNDPLDAAALP
FT                   FVYEGMSGGLRALPTLAVVLGYPGFWAREPDTGIDWVKLLHGEQRVRWHRPLPADCEVI
FT                   GKSRITHLIDKGEGKGAILVTERLLETRAGALLATLQQVTFLRGDGGYSQHGGGQPSDE
FT                   PLPALQPTPQDRAPDFTDTQAIRPEAALLYRLMGDYNPLHAEPEVARKAGFERPILHGL
FT                   ASYGLVARAVLRQCAGGDPALLKALDIRFASPVYPGETLVTEIWRVPGQPGKIQLRARV
FT                   AERDKVVLSHGYAELA"
FT                   /product="3-alpha,7-alpha,
FT                   12-alpha-trihydroxy-5-beta-cholest-24-enoyl-coahydratase"
FT                   /protein_id="YP_004124838.1"
     MAIDYRHLKN RAFEPVHQHY TERDTMLYAL SLGLGNDPLD AAALPFVYEG MSGGLRALPT        60
     LAVVLGYPGF WAREPDTGID WVKLLHGEQR VRWHRPLPAD CEVIGKSRIT HLIDKGEGKG       120
     AILVTERLLE TRAGALLATL QQVTFLRGDG GYSQHGGGQP SDEPLPALQP TPQDRAPDFT       180
     DTQAIRPEAA LLYRLMGDYN PLHAEPEVAR KAGFERPILH GLASYGLVAR AVLRQCAGGD       240
     PALLKALDIR FASPVYPGET LVTEIWRVPG QPGKIQLRAR VAERDKVVLS HGYAELA          297
//

If you have problems or comments...

PBIL Back to PBIL home page