(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE164

ALDEN1_2.PE164       Location/Qualifiers
FT   CDS             182553..183347
FT                   /locus_tag="Alide_0166"
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   dia:Dtpsy_0140 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="GI:319760902"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="GeneID:10102189"
FT                   /translation="MSASPVLTSVQDGVGTITLNRPEARNALNQAMRPALAAAIAQMRD
FT                   DKEVYAVILTGAGGAFCSGGDISAMLDTSRTGLTFRAGMRELHQWFPELVNLEKPVIAA
FT                   VDGPAFGAGLSLALSADFVLATRRARFCAVFGRIGLIPDLGALHLLPRIVGMQKAKELV
FT                   FTARTVEVEEARQLGMVYDVVEDGAALHAAALALARRFGEASTAAIGMAKTIMNQSFES
FT                   SARTIAELESYGQAMCRGSAYHQEAVQRFKDKQPLRFDWDKK"
FT                   /protein_id="YP_004124839.1"
     MSASPVLTSV QDGVGTITLN RPEARNALNQ AMRPALAAAI AQMRDDKEVY AVILTGAGGA        60
     FCSGGDISAM LDTSRTGLTF RAGMRELHQW FPELVNLEKP VIAAVDGPAF GAGLSLALSA       120
     DFVLATRRAR FCAVFGRIGL IPDLGALHLL PRIVGMQKAK ELVFTARTVE VEEARQLGMV       180
     YDVVEDGAAL HAAALALARR FGEASTAAIG MAKTIMNQSF ESSARTIAEL ESYGQAMCRG       240
     SAYHQEAVQR FKDKQPLRFD WDKK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page