(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE165

ALDEN1_2.PE165       Location/Qualifiers
FT   CDS             183484..184767
FT                   /locus_tag="Alide_0167"
FT                   /gene_family="HOG000223272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02550"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ajs:Ajs_0123 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="GI:319760903"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="GeneID:10102190"
FT                   /translation="MSALADRLRQLIRPGDTLWWGQTTAEPLTLTRAVTAHRHALAQGA
FT                   RLRVFVGIAASDTLAPEQADAIDFFGYAAGGAHRRLADAGVLDILPCHYSHLPGLIRAG
FT                   VLPVDVVLLQVSPPDEQGRYSLGLAQEYLPAALEKARVVIAEVNPGIPWTHGGVHLRTG
FT                   DFALCIDAEHPPLEQSRSAPGPAEQAIARHIAALVEDGATLQLGVGNLPEAVLAALHGH
FT                   RDLGLHSGAVGDGIARLAEAGVLTNAKKSVDAGVGVGGILMGSECLRRWAHRNQQLALR
FT                   GTEYTHDPEVLAASHKLAAINAAIEVDLTGQINAEVAAGCYVGAVGGAVDFLRGAARSK
FT                   GGLPIVALPATAKGASRIVARLSGPVSTPRSDAGLIVTEHGVADLRGQPLSRRVRRLID
FT                   IAAPEHREDLERQAYETLRRCGAAFNQK"
FT                   /protein_id="YP_004124840.1"
     MSALADRLRQ LIRPGDTLWW GQTTAEPLTL TRAVTAHRHA LAQGARLRVF VGIAASDTLA        60
     PEQADAIDFF GYAAGGAHRR LADAGVLDIL PCHYSHLPGL IRAGVLPVDV VLLQVSPPDE       120
     QGRYSLGLAQ EYLPAALEKA RVVIAEVNPG IPWTHGGVHL RTGDFALCID AEHPPLEQSR       180
     SAPGPAEQAI ARHIAALVED GATLQLGVGN LPEAVLAALH GHRDLGLHSG AVGDGIARLA       240
     EAGVLTNAKK SVDAGVGVGG ILMGSECLRR WAHRNQQLAL RGTEYTHDPE VLAASHKLAA       300
     INAAIEVDLT GQINAEVAAG CYVGAVGGAV DFLRGAARSK GGLPIVALPA TAKGASRIVA       360
     RLSGPVSTPR SDAGLIVTEH GVADLRGQPL SRRVRRLIDI AAPEHREDLE RQAYETLRRC       420
     GAAFNQK                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page