(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE166

ALDEN1_2.PE166       Location/Qualifiers
FT   CDS             184834..186042
FT                   /locus_tag="Alide_0168"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   ajs:Ajs_0124 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="GI:319760904"
FT                   /db_xref="GO:0003941"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="GeneID:10102191"
FT                   /translation="MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVQKSGIDP
FT                   ARIDDVVMAQSYANSEVPCVGRWAALQAGLPVEVPGMQLDRRCGGGLQAIVTASMMVQS
FT                   GAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMI
FT                   ETAENLARDYSITRDEADAYALRSHQRAAAAWAAGRFADEVVPVQVPQRKGDPVTFARD
FT                   EGFRADVTTESLAKLRVLMPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLV
FT                   GWAAAGCEPSHMGIGPVPAVKKLLARLSLKIDDMDLVELNEAFACQVLAVLKGWGWQDQ
FT                   GAIEHKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIAAVF
FT                   ERV"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_004124841.1"
     MRRAAIVTPV RTPVGTFGGS LRPVPVEELA ATTVRAVVQK SGIDPARIDD VVMAQSYANS        60
     EVPCVGRWAA LQAGLPVEVP GMQLDRRCGG GLQAIVTASM MVQSGAADVV IAGGVESMSN       120
     IEYYSTDMRW GARSGNVRFY DRLDRGRERS QPVERFGKIS GMIETAENLA RDYSITRDEA       180
     DAYALRSHQR AAAAWAAGRF ADEVVPVQVP QRKGDPVTFA RDEGFRADVT TESLAKLRVL       240
     MPNGTVTAGN ASQQNDASAA CLIVAEDKLA ELGLTPMATL VGWAAAGCEP SHMGIGPVPA       300
     VKKLLARLSL KIDDMDLVEL NEAFACQVLA VLKGWGWQDQ GAIEHKLNVN GSGISLGHPI       360
     GATGVRILAT LLHELQRRKG RYGLETMCIG GGQGIAAVFE RV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page