(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE167

ALDEN1_2.PE167       Location/Qualifiers
FT   CDS             complement(186057..186980)
FT                   /locus_tag="Alide_0169"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_0188 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760905"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102192"
FT                   /translation="MDLNLVRMFIAIAESRNLTDAARRSGMTRSNVSRRLKALEREYGA
FT                   QLLRRTTRHVELTQAGRILYGHCQQAMNELQDAQRKIEQMHRTVSGEIRVRIPTGLGHF
FT                   YLKPLILEFCKNHPELQLRLVINDQIHDLVASKVDLAIHITSAPLVDHVATKVCDIRWC
FT                   LVCTPQYLQQHALHLEQPVDLKQARLIAPLALGQRVEFTGPGGAGKVLVQHGASIQSGD
FT                   YQFLFNAASQGLGIALLPSYAVCEALKRGDLVRVLQRYEVMGIGNALYVVRASNRQPSA
FT                   ATVAFIDLLTTSVRAMAPHWDLHDAP"
FT                   /protein_id="YP_004124842.1"
     MDLNLVRMFI AIAESRNLTD AARRSGMTRS NVSRRLKALE REYGAQLLRR TTRHVELTQA        60
     GRILYGHCQQ AMNELQDAQR KIEQMHRTVS GEIRVRIPTG LGHFYLKPLI LEFCKNHPEL       120
     QLRLVINDQI HDLVASKVDL AIHITSAPLV DHVATKVCDI RWCLVCTPQY LQQHALHLEQ       180
     PVDLKQARLI APLALGQRVE FTGPGGAGKV LVQHGASIQS GDYQFLFNAA SQGLGIALLP       240
     SYAVCEALKR GDLVRVLQRY EVMGIGNALY VVRASNRQPS AATVAFIDLL TTSVRAMAPH       300
     WDLHDAP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page