(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE168

ALDEN1_2.PE168       Location/Qualifiers
FT   CDS             187158..188342
FT                   /locus_tag="Alide_0170"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dac:Daci_0189 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="GI:319760906"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102193"
FT                   /translation="MGTTPVQELMPLQGFTVLDLSQGVAGPYCAQLLAGQGARVIKVEP
FT                   PQGDWGRHVGVASDGHSTISSTYNSGKQSLAIDARRPEGRAVILRLAERADVIVQNFRP
FT                   QVVERLGLDYESLRARGLGPVYVSISGYGPDGPFADHPATDSVMQADSGLMHTNRDAGG
FT                   TPQRIGLLLADIAAGVYAAQACTAALLHKTRTAEGSHVQISLFNVCCALQSTVFSEELA
FT                   GAQAARQPVSAPNGIFDAADGKLTILALNNEQFLRICKAFDLRHWETDPRFASNALRLE
FT                   HKALLHAELSRKVAPQSLAQLEALLGQHQVLHARVREGRGVVEHPQARHLHTFQTIEQP
FT                   GFGPLLWAAAPWACHAGAAQPAPRIGEHSQAILHGLGLDAQEIAALVAQQVVAV"
FT                   /protein_id="YP_004124843.1"
     MGTTPVQELM PLQGFTVLDL SQGVAGPYCA QLLAGQGARV IKVEPPQGDW GRHVGVASDG        60
     HSTISSTYNS GKQSLAIDAR RPEGRAVILR LAERADVIVQ NFRPQVVERL GLDYESLRAR       120
     GLGPVYVSIS GYGPDGPFAD HPATDSVMQA DSGLMHTNRD AGGTPQRIGL LLADIAAGVY       180
     AAQACTAALL HKTRTAEGSH VQISLFNVCC ALQSTVFSEE LAGAQAARQP VSAPNGIFDA       240
     ADGKLTILAL NNEQFLRICK AFDLRHWETD PRFASNALRL EHKALLHAEL SRKVAPQSLA       300
     QLEALLGQHQ VLHARVREGR GVVEHPQARH LHTFQTIEQP GFGPLLWAAA PWACHAGAAQ       360
     PAPRIGEHSQ AILHGLGLDA QEIAALVAQQ VVAV                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page