(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE17

ALDEN1_2.PE17        Location/Qualifiers
FT   CDS             21566..22195
FT                   /locus_tag="Alide_0017"
FT                   /gene_family="HOG000258615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   KEGG: ajs:Ajs_4160 DNA polymerase III, epsilon subunit;
FT                   SMART: Exonuclease"
FT                   /db_xref="GI:319760755"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="GeneID:10102040"
FT                   /translation="MPSPIAVIDFETTGMTPAQGARATEVAIVLMEGERVVDRFASLMK
FT                   TGVWIPPFITRLTGITNAMVDAAPAAEPVMREAARFVGDAPMVAHNAAFDSRFWQSELR
FT                   HAGLDAPHPFACTVLLSRRIYPDAPSHSLGRLTDHLGLPRTGRAHRALADAEMAAALLA
FT                   RMQHELCRRFGLDWPDHALLMRLQRCARQSMGRMLLEQRQIANASG"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_004124692.1"
     MPSPIAVIDF ETTGMTPAQG ARATEVAIVL MEGERVVDRF ASLMKTGVWI PPFITRLTGI        60
     TNAMVDAAPA AEPVMREAAR FVGDAPMVAH NAAFDSRFWQ SELRHAGLDA PHPFACTVLL       120
     SRRIYPDAPS HSLGRLTDHL GLPRTGRAHR ALADAEMAAA LLARMQHELC RRFGLDWPDH       180
     ALLMRLQRCA RQSMGRMLLE QRQIANASG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page